QAMVVKPLFPWDETLKFDHFSIILAPGALSESTPHEAGVIEHVVVISGELEMKIDGEWRTLYPDQGVRFAGDKPHAYRNS
SSRPVHFHSLIHYPR
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6b8w:B | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.08e-67 | |
2 | 1y9q:A | 178 | 93 | 0.3158 | 0.1685 | 0.3226 | 4.43e-12 | |
3 | 2h0v:A | 335 | 68 | 0.2211 | 0.0627 | 0.3088 | 0.002 | 2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B |
4 | 4hwv:A | 498 | 63 | 0.1789 | 0.0341 | 0.2698 | 0.64 | 4hwv:B |
5 | 7b04:A | 409 | 44 | 0.1368 | 0.0318 | 0.2955 | 1.1 | 7b04:D, 7b04:G, 7b04:J, 7b04:M, 7b04:P, 7b04:S, 7b04:V |
6 | 5tg0:A | 137 | 65 | 0.1895 | 0.1314 | 0.2769 | 1.4 | 6a53:A, 6a53:B, 6a54:A, 6a54:B, 6a55:A, 6a55:B, 8hlf:A, 8hlf:B, 5tfz:A, 5tfz:B |
7 | 3ml4:C | 208 | 59 | 0.1263 | 0.0577 | 0.2034 | 1.7 | 3ml4:A, 3ml4:B, 3ml4:D |
8 | 4xai:A | 565 | 50 | 0.1579 | 0.0265 | 0.3000 | 1.9 | 4xai:B |
9 | 8ayr:A | 677 | 56 | 0.1789 | 0.0251 | 0.3036 | 2.9 | 8ayr:B |
10 | 5qhi:A | 169 | 41 | 0.1474 | 0.0828 | 0.3415 | 6.8 | 5qhi:B, 5qhj:A, 5qhj:B, 5qhk:A, 5qhk:B, 5qhl:A, 5qhl:B, 5qhm:A, 5qho:A, 5qhp:A, 5qhq:A, 5qhr:A, 5qhs:A |
11 | 3av4:A | 1140 | 37 | 0.1158 | 0.0096 | 0.2973 | 6.9 | 3av5:A, 3av6:A, 4da4:B, 5gut:A, 5guv:A, 3pt9:A, 6w8v:B, 6w8w:A, 6w8w:B, 5wy1:A |