QALYEKLEQTRTILSVKLAELINMTTISELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLFDEKQIEELLDNCI
ETFVAEKT
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rj1:K | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 7.10e-58 | |
2 | 6cnb:R | 522 | 66 | 0.1591 | 0.0268 | 0.2121 | 7.9 | 8cen:O, 8ceo:O, 6cnc:R, 6cnd:R, 6cnf:R, 6eu0:Y, 6f40:U, 6f41:U, 6f42:U, 6f44:U, 8ffz:H, 5fmf:Q, 5fyw:O, 5fz5:O, 6gyk:O, 6gyl:O, 6gym:O, 7ml0:O, 7ml1:O, 7ml2:O, 7ml4:O, 1ngm:A, 1ngm:E, 1ngm:I, 1ngm:M, 1nh2:A, 7o4i:O, 7o4j:O, 7o72:O, 7o73:O, 7o75:O, 7oh9:K, 7oha:K, 7ohb:K, 5oqj:O, 5oqm:O, 7q5b:Y, 1rm1:A, 5sva:j, 4v1n:O, 4v1o:O, 1ytb:A, 1ytb:B, 1ytf:A, 7z7n:D, 7zb5:D, 7zb5:G, 7zs9:O, 7zsa:O, 7zsb:O |