QAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRF
DSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQ
FWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILT
VYGTCMPMLNLTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA
The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1d5y:A | 288 | 288 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1d5y:B, 1d5y:D, 1d5y:C, 7vwy:G, 7vwz:G, 7vwz:I |
2 | 7w5w:J | 107 | 99 | 0.1979 | 0.5327 | 0.5758 | 1.66e-35 | 7w5x:K, 7w5y:K |
3 | 1xs9:A | 129 | 101 | 0.1771 | 0.3953 | 0.5050 | 1.68e-30 | 1bl0:A |
4 | 7bef:G | 106 | 103 | 0.1736 | 0.4717 | 0.4854 | 1.34e-28 | 7beg:G |
5 | 4fe7:A | 380 | 92 | 0.1007 | 0.0763 | 0.3152 | 1.25e-06 | |
6 | 3w6v:A | 111 | 92 | 0.0694 | 0.1802 | 0.2174 | 0.022 | |
7 | 1wpk:A | 146 | 47 | 0.0625 | 0.1233 | 0.3830 | 0.13 | 1adn:A, 1eyf:A, 1u8b:A, 1zgw:A |
8 | 5xbt:A | 271 | 131 | 0.1146 | 0.1218 | 0.2519 | 2.7 | 5xbi:A, 5xbi:B, 5xbt:B, 5xql:A |