BioLiP

>protein
QAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELK
KKYGI

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1aca:A	86	85	0.9294	0.9186	0.9294	2.50e-55	2cb8:A, 2cb8:B, 2fj9:A, 1nvl:A
2	3epy:A	88	85	0.6235	0.6023	0.6235	2.44e-33	3epy:B
3	3fp5:A	106	86	0.5294	0.4245	0.5233	3.15e-27
4	2wh5:A	90	86	0.4353	0.4111	0.4302	5.82e-20	2wh5:B, 2wh5:C, 2wh5:D, 2wh5:F, 2wh5:E
5	3flv:A	92	85	0.4353	0.4022	0.4353	6.15e-16	3flv:B
6	7fc7:A	96	87	0.4118	0.3646	0.4023	3.04e-14
7	1hbk:A	89	60	0.2353	0.2247	0.3333	3.30e-09
8	4v4c:A	875	48	0.1647	0.0160	0.2917	1.9	4v4c:C, 4v4c:E, 4v4c:G, 4v4c:I, 4v4c:K, 4v4c:M, 4v4c:O, 4v4c:Q, 4v4c:S, 4v4c:U, 4v4c:W, 4v4d:A, 4v4d:C, 4v4d:E, 4v4d:G, 4v4d:I, 4v4d:K, 4v4d:M, 4v4d:O, 4v4d:Q, 4v4d:S, 4v4d:U, 4v4d:W, 4v4e:A, 4v4e:C, 4v4e:E, 4v4e:G, 4v4e:I, 4v4e:K, 4v4e:M, 4v4e:O, 4v4e:Q, 4v4e:S, 4v4e:U, 4v4e:W
9	4y0k:A	405	42	0.1176	0.0247	0.2381	2.0	4y1b:A
10	8hs7:A	126	27	0.1176	0.0794	0.3704	4.0
11	3ram:A	391	79	0.2353	0.0512	0.2532	5.5	3ram:B, 3ram:C, 3ram:D
12	7xpg:A	463	24	0.1294	0.0238	0.4583	6.4	7xpg:B, 7xpg:C
13	5awp:A	596	26	0.1294	0.0185	0.4231	8.3	5awq:A
14	3ue1:A	604	26	0.1294	0.0182	0.4231	8.4	3udi:A, 3udi:B, 3udx:A, 3udx:B, 3ue0:A, 3ue0:B, 3ue1:B

[Back]