BioLiP

>protein
QADQIRTWVQSESSGHDWLHISRVADLAVYIGEKENADLFIVETAALVHDLIDVKLPDTIRLSVSEVYNQLVTFGIGKED
ADRVIHIITKMSFRDRIEGKVVQDADRLDAIGAVGIARAFMFAGAKGHGLYGDDQSAYAHFFHKLLRLIDMMNTDTAREL
AEERHEFMLQYIRQLEKDIPGID

The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5dqw:A	188	183	0.9617	0.9362	0.9617	1.71e-125	5dqw:B
2	2qgs:A	209	189	0.4153	0.3636	0.4021	1.35e-43	2qgs:B
3	3djb:A	188	174	0.4153	0.4043	0.4368	1.01e-41	3djb:B
4	3b57:A	180	180	0.3880	0.3944	0.3944	3.58e-34
5	2pq7:A	174	169	0.2678	0.2816	0.2899	1.91e-11
6	8d33:A	974	49	0.1038	0.0195	0.3878	0.52	8d37:A, 8d3r:A, 8d42:A, 8udl:A, 8v54:A
7	6o3l:H	223	78	0.0874	0.0717	0.2051	1.3	6o3l:A, 6o3u:H, 6o3u:B, 6o3u:D, 6o3u:F
8	6c66:H	329	100	0.1202	0.0669	0.2200	4.3	5u07:I, 5u0a:I
9	3bsg:A	404	41	0.0656	0.0297	0.2927	4.3	3bsh:A, 1ht6:A, 1p6w:A, 2qps:A, 2qpu:B, 2qpu:A, 2qpu:C, 1rp8:A, 1rp9:A, 1rpk:A
10	8auh:A	365	38	0.0765	0.0384	0.3684	8.1	8a8i:B, 8a8i:D, 8au8:A, 8au8:B, 8au9:B, 8au9:A, 8auf:A, 8auf:B, 8aug:A, 8aug:B, 8auh:B, 8aui:A, 8aui:B, 5cpl:A, 5cpl:B, 5cpm:A, 5cpm:B, 5cpn:A, 5cpn:B, 5cpo:A, 5cpo:B, 2h8x:A, 2h8z:A, 2h90:A, 3l5l:A, 3l5m:A, 3l65:A, 3l66:A, 3l67:A, 3l68:A, 5lni:A, 5lnj:A, 3n14:A, 3n19:B, 3n19:D, 5n6q:A, 5n6q:B, 4uth:A, 4uti:A, 4utj:A, 4utk:A, 4utl:A, 4utm:A

[Back]