PYTIELIQPEDGEAVIAMLKTFFFKDNPLNTFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDD
VPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVL
CSSHYSARVMEKLGFHEVFRMQFADYKPQGEVVFKPAAPHVGIQVMAKEV
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k80:A | 213 | 210 | 0.9952 | 0.9812 | 0.9952 | 8.80e-157 | 5gi5:A, 5gi6:A, 5gi7:A, 5gi8:A, 5gi9:A, 5gif:A, 5gig:A, 5gih:A, 5gii:A, 3te4:A |
2 | 6v3t:A | 213 | 193 | 0.3048 | 0.3005 | 0.3316 | 7.23e-22 | 6v3t:B, 6v3t:C, 6v3t:D, 6v3t:E, 6v3t:G |
3 | 7ciw:A | 216 | 195 | 0.2286 | 0.2222 | 0.2462 | 6.30e-12 | 7civ:A, 7cix:A |
4 | 5ib0:A | 137 | 36 | 0.0667 | 0.1022 | 0.3889 | 0.73 | 5ib0:B, 5ib0:C, 5ib0:G |
5 | 3qb8:A | 197 | 81 | 0.0905 | 0.0964 | 0.2346 | 1.2 | 3qb8:B |
6 | 6ygb:A | 159 | 89 | 0.1381 | 0.1824 | 0.3258 | 1.4 | 6ygc:A, 6ygd:A |
7 | 4r8i:A | 68 | 66 | 0.0905 | 0.2794 | 0.2879 | 1.9 | |
8 | 1a7a:A | 431 | 109 | 0.1333 | 0.0650 | 0.2569 | 4.7 | 1a7a:B, 5axa:A, 5axa:C, 5axb:A, 5axb:C, 5axc:A, 5axc:C, 5axd:A, 5axd:C, 1b3r:A, 1b3r:B, 1b3r:C, 1b3r:D, 8cod:A, 8cod:B, 1d4f:A, 1d4f:B, 1d4f:C, 1d4f:D, 2h5l:A, 2h5l:B, 2h5l:C, 2h5l:D, 2h5l:E, 2h5l:F, 2h5l:G, 2h5l:H, 1k0u:A, 1k0u:B, 1k0u:C, 1k0u:D, 1k0u:E, 1k0u:F, 1k0u:G, 1k0u:H, 1ky4:A, 1ky4:B, 1ky4:C, 1ky4:D, 1ky5:A, 1ky5:B, 1ky5:C, 1ky5:D, 1li4:A, 3nj4:A, 3nj4:B, 3nj4:C, 3nj4:D, 4pfj:A, 4pfj:B, 4pgf:A, 4pgf:B, 5w49:A, 5w49:B, 5w4b:A, 5w4b:B, 5w4b:C, 5w4b:D, 5w4b:E, 5w4b:F, 1xwf:A, 1xwf:B, 1xwf:C, 1xwf:D, 4yvf:A, 4yvf:B |
9 | 7l1k:A | 149 | 53 | 0.0762 | 0.1074 | 0.3019 | 5.2 | |
10 | 7txj:a | 199 | 47 | 0.0714 | 0.0754 | 0.3191 | 5.4 | |
11 | 3eqm:A | 452 | 70 | 0.0952 | 0.0442 | 0.2857 | 5.4 | 4gl5:A, 4gl7:A, 5jkv:A, 5jkw:A, 5jl6:A, 5jl7:A, 5jl9:A, 4kq8:A, 3s79:A, 3s7s:A |
12 | 4twr:A | 325 | 39 | 0.0714 | 0.0462 | 0.3846 | 6.3 | 4wok:A |
13 | 3pp9:A | 176 | 26 | 0.0476 | 0.0568 | 0.3846 | 6.7 | 3pp9:B, 3pp9:C |
14 | 3f8k:A | 131 | 74 | 0.1048 | 0.1679 | 0.2973 | 6.7 | |
15 | 7tvz:A | 850 | 42 | 0.0714 | 0.0176 | 0.3571 | 7.0 | 8crq:C, 8crq:E, 8crr:C, 8crr:E, 8crt:C, 8crt:E, 8ct3:C, 8ct3:E, 8t3r:B, 8t44:B, 8t47:B, 8t47:A, 8t6u:A, 8t6u:B, 8t6v:A, 8t6v:B, 7tvz:B, 7ty4:A, 7ty4:B, 7ty6:A, 7ty6:B, 7ty7:A, 7ty7:B, 7ty8:A, 7ty8:B, 7tya:A, 7tya:B, 7uz3:C, 7uz3:E, 7v07:C, 7v07:E, 7v19:C, 7v19:E |
16 | 8cs9:g | 832 | 42 | 0.0714 | 0.0180 | 0.3571 | 7.1 | 8cs9:V, 8cs9:e, 8cs9:Y, 8cs9:f, 8cs9:Z, 8cte:P, 8cte:T, 7v0k:O, 7v0k:P |
17 | 3pgb:A | 740 | 34 | 0.0571 | 0.0162 | 0.3529 | 8.3 |