PYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTN
The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8i0r:v | 173 | 38 | 1.0000 | 0.2197 | 1.0000 | 1.58e-23 | 7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B |
2 | 8ch6:I | 185 | 38 | 0.9211 | 0.1892 | 0.9211 | 4.89e-19 | 7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v |
3 | 6g90:U | 196 | 38 | 0.5000 | 0.0969 | 0.5000 | 3.81e-06 | 7oqb:U, 7oqe:U |
4 | 5nrl:U | 196 | 38 | 0.5000 | 0.0969 | 0.5000 | 3.85e-06 | |
5 | 7dco:v | 207 | 38 | 0.5000 | 0.0918 | 0.5000 | 4.55e-06 | 5gm6:I, 5zwm:v, 5zwo:v |
6 | 8qzs:r | 114 | 33 | 0.3158 | 0.1053 | 0.3636 | 0.040 | 7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r |
7 | 8idf:A | 459 | 28 | 0.2895 | 0.0240 | 0.3929 | 0.23 | |
8 | 1xed:A | 111 | 38 | 0.3158 | 0.1081 | 0.3158 | 0.25 | 1xed:B |
9 | 8ost:A | 390 | 29 | 0.3158 | 0.0308 | 0.4138 | 0.73 | |
10 | 6iw6:A | 438 | 29 | 0.3158 | 0.0274 | 0.4138 | 0.73 | 6iw6:B |
11 | 1zu1:A | 127 | 24 | 0.2632 | 0.0787 | 0.4167 | 0.91 | |
12 | 7mo3:B | 38 | 31 | 0.2368 | 0.2368 | 0.2903 | 1.4 | 7mo3:D, 7mo4:B, 7mo4:D |
13 | 2ebv:A | 57 | 31 | 0.2368 | 0.1579 | 0.2903 | 2.3 | |
14 | 8pv1:Cb | 101 | 31 | 0.2895 | 0.1089 | 0.3548 | 3.2 | 8pv2:Cb, 8pv3:Cb, 8pv4:Cb, 8pv5:Cb, 8pv6:Cb, 8pv7:Cb, 8pv8:Cb, 8pvk:Cb, 8pvl:Cb |