PWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTLAYNTGAAFSFLADSSGWQRWLFALIAIVVSASLVVWLKR
LKKGETWLAIALALVLGGALGNLYDRMVLGHVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALDMFR
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5dir:A | 157 | 148 | 0.9933 | 0.9427 | 1.0000 | 8.50e-103 | 5dir:C, 5dir:D, 5dir:B, 6fms:A, 6fms:B, 6fms:C, 6fms:D |
2 | 6ryp:A | 164 | 147 | 0.3020 | 0.2744 | 0.3061 | 4.17e-15 | 6ryo:A |
3 | 7c79:B | 793 | 67 | 0.1141 | 0.0214 | 0.2537 | 1.6 | 6agb:B, 6ah3:B, 7c7a:B, 6w6v:B |