PWEFRKVIQAEYRERKIMIGSILRLLETNTVSALDSVFEKYEKEMNQMTHGDNNEVKRIYSKKERLLEIILTKIKKKLRQ
AKFPSRISERDLDIEYIYSKRQFIQNRYSQELQNNERLEAILSREQNLLEETRKLCMNLKTNNKKRLTEKLIQKDLHPVL
NKAMEYTYGLEPDGPVTFRNDSHELNLMLNDPIKSTADVRLDKEEVLSLLPSLKEYTKKSKELKETMGQMISDSHEEEIK
EVFVPHH
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ow1:QQ | 247 | 247 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6nuw:F | 190 | 218 | 0.7692 | 1.0000 | 0.8716 | 1.06e-126 | |
3 | 8t0p:A | 152 | 149 | 0.5466 | 0.8882 | 0.9060 | 1.28e-88 | |
4 | 6uqk:A | 2054 | 143 | 0.1377 | 0.0166 | 0.2378 | 2.2 | 6uqk:B, 6uqk:C, 6uqk:D |
5 | 6ihd:B | 304 | 52 | 0.0688 | 0.0559 | 0.3269 | 4.1 | 6ihd:A, 6ihe:A, 6ihe:B |
6 | 7t3q:A | 2103 | 136 | 0.1336 | 0.0157 | 0.2426 | 9.5 | 7t3q:B, 7t3q:C, 7t3q:D, 7t3u:B |