PVSNAQLTQMFEHVLKLSRVDETQSVAVLKSHYSDPRTVNAAMEAAQRLKAKVYAVELPAFNHPTAMGNDMTAYCGDTAL
TGNLAAQRALEAADLVVDTMMLLHSPEQEQILKTGTRILLAVEPPEVLARMLPTEDDKRRVLAAETLLKQARSLHVRSKA
GSDFHAPLGQYPAVTEYGYADEPGRWDHWPSGFLFTWPNEDSAEGTLVLDVGDIILPFKNYCRERITLEIEKGFITGIHG
GFEAEYLRDYMKYFNDPEVYGISHIGWGLQPRAQWTAMGLHDRNDGMCMDARAFYGNFLFSTGPNTEVGGKRKTPCHLDI
PLRNCDIYLDDKAVVLAGDVVAPEESRAR
The query sequence (length=349) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cn3:C | 349 | 349 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7cn3:A, 7cn3:B, 7cn3:D, 7cn3:E, 7cn3:F, 7cnt:A, 7cnt:B, 7cnt:C, 7cnt:D, 7cnt:E, 7cnt:F, 7cup:A, 7cup:B, 7cup:C, 7cup:D, 7cup:E, 7cup:F |
2 | 8bp8:e | 397 | 36 | 0.0401 | 0.0353 | 0.3889 | 2.0 | 3gzu:J, 1qhd:A |
3 | 4cg4:C | 376 | 114 | 0.0860 | 0.0798 | 0.2632 | 5.6 | 4cg4:D, 4cg4:E, 4cg4:F |
4 | 4jap:C | 353 | 32 | 0.0401 | 0.0397 | 0.4375 | 5.9 | 4jao:C, 4jao:B, 4jap:B, 4jap:A, 4jaq:D, 4jaq:A, 4jaq:C, 4jaq:B, 4jd3:C, 4jd3:B |
5 | 5anb:K | 1120 | 76 | 0.0630 | 0.0196 | 0.2895 | 6.0 | 5anc:K |
6 | 7myv:B | 239 | 35 | 0.0372 | 0.0544 | 0.3714 | 7.3 | 7myv:A |
7 | 8azw:h | 288 | 45 | 0.0458 | 0.0556 | 0.3556 | 7.6 | 8b2l:h3, 7qiw:G, 7qiz:G |
8 | 9gpj:A | 184 | 84 | 0.0630 | 0.1196 | 0.2619 | 9.6 | 6dcl:A, 6dcl:B, 9f4d:A, 9f4e:A, 9f4f:A, 9f4g:A, 9f4h:A, 9f4j:A, 9f4k:A, 9f4l:A, 9f4m:A, 9f4n:A, 9f4o:A, 9f4p:A, 9f4q:A, 9f4r:A, 9f4s:A, 9f4t:A, 9f4u:A, 9f4v:A, 9f4w:A, 9f4x:A, 9f4y:A, 9f4z:A, 9f50:A, 9f51:A, 9f52:A, 9f53:A, 9f54:A, 9f55:A, 9f5c:A, 9f5d:A, 9f5e:A, 9f5f:A, 9f5g:A, 9f5k:A, 9f7f:A, 9f7h:A, 5mpg:A, 5mpl:A, 1pgz:A, 1po6:A, 8rzv:A, 1u1k:A, 1u1l:A, 1u1m:A, 1u1n:A, 1u1o:A, 1u1p:A, 1u1q:A, 1u1r:A, 2up1:A, 4yoe:A |