PVNLIFCYTILQMKVAERIMAQHPGERFYVVLMSENRNEKYDYYFNQIKDKAEWAYFFHLPYGLNKSFNFIPTMAELKVK
AMLLPKVKRIYLASLEKVSIAAFLSTYPDAEIKTFDDGTINLIQSSSYLGDEFSVNGTIKRNFARMMIGDWSIAKTRNAS
DEHYTIFKGLKNIMDDGRRKMTYLPLFDASELKAGDETGGTVRILLGSPDKEMKEISEKAAKNFNIQYVAPHPRQTYGLS
GVTTLNSPYVIEDYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALKPASLPEDYWLKPVYALFTQSGIPILTFD
DKLVP
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yk4:A | 326 | 325 | 1.0000 | 0.9969 | 1.0000 | 0.0 | 2yk5:A, 2yk6:A, 2yk7:A |
2 | 7tbw:A | 1928 | 95 | 0.0862 | 0.0145 | 0.2947 | 0.015 | |
3 | 7tby:A | 1788 | 55 | 0.0523 | 0.0095 | 0.3091 | 0.72 | 7tc0:A |
4 | 5gvv:A | 392 | 71 | 0.0738 | 0.0612 | 0.3380 | 1.3 | 5gvv:F, 5gvw:C, 5gvw:A, 5gvw:B, 5gvw:D |
5 | 8j4q:D | 724 | 81 | 0.0892 | 0.0401 | 0.3580 | 2.8 | 8j4q:A, 8j4q:B, 8j4q:C, 8j4r:A, 8j4r:B, 8j4r:C, 8j4r:D, 6lfk:A, 6lfk:B, 6lfk:C, 6lfk:D |
6 | 7roq:A | 1831 | 49 | 0.0523 | 0.0093 | 0.3469 | 3.8 | |
7 | 7kq3:A | 825 | 251 | 0.1569 | 0.0618 | 0.2032 | 4.4 | 7kq3:B, 7kq3:C, 7kq3:D |
8 | 7aoe:B | 1174 | 116 | 0.0923 | 0.0256 | 0.2586 | 8.3 | 7aoc:B, 7aod:B, 7aod:N |
9 | 5h39:A | 285 | 37 | 0.0400 | 0.0456 | 0.3514 | 9.3 | 5h38:B, 5h39:B, 5h3a:A, 5h3a:B |