PVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTI
SGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAE
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ozb:A | 144 | 144 | 1.0000 | 1.0000 | 1.0000 | 1.75e-106 | 1ozb:B, 1ozb:C, 1ozb:D |
2 | 5jtm:A | 155 | 143 | 0.5625 | 0.5226 | 0.5664 | 3.04e-64 | 5jtm:B, 5jtm:C, 5jtm:D, 5jtp:A, 5jtp:B, 5jtp:C, 5jtp:D |
3 | 3cty:B | 305 | 55 | 0.1111 | 0.0525 | 0.2909 | 0.31 | 3cty:A |
4 | 2r9v:A | 487 | 123 | 0.1944 | 0.0575 | 0.2276 | 1.6 | |
5 | 5jdo:A | 249 | 30 | 0.0972 | 0.0562 | 0.4667 | 2.3 | 5jdo:B |
6 | 8p2f:E | 670 | 72 | 0.1250 | 0.0269 | 0.2500 | 3.5 | 8p2g:E, 8p2h:E |
7 | 3hko:A | 319 | 24 | 0.0833 | 0.0376 | 0.5000 | 4.6 | |
8 | 8udk:B | 369 | 30 | 0.0764 | 0.0298 | 0.3667 | 5.6 | |
9 | 3kd3:A | 216 | 58 | 0.1111 | 0.0741 | 0.2759 | 6.3 | 3kd3:B |
10 | 5mtw:C | 138 | 23 | 0.0764 | 0.0797 | 0.4783 | 7.4 | 5mtw:A, 5mtw:D, 5mtw:B |
11 | 7v2h:l | 606 | 36 | 0.0903 | 0.0215 | 0.3611 | 8.2 | 7vc0:l, 7vy1:l, 7vys:l, 7w0h:l, 7w2l:l, 7w2r:l, 7w2y:l, 7w32:l, 7w4q:l |
12 | 2v5e:A | 200 | 46 | 0.0903 | 0.0650 | 0.2826 | 8.9 |