PVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTI
SGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMN
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ozb:A | 144 | 136 | 1.0000 | 0.9444 | 1.0000 | 3.54e-100 | 1ozb:B, 1ozb:C, 1ozb:D |
2 | 5jtm:A | 155 | 134 | 0.5735 | 0.5032 | 0.5821 | 5.53e-62 | 5jtm:B, 5jtm:C, 5jtm:D, 5jtp:A, 5jtp:B, 5jtp:C, 5jtp:D |
3 | 2r9v:A | 487 | 123 | 0.2059 | 0.0575 | 0.2276 | 1.1 | |
4 | 5jdo:A | 249 | 32 | 0.1250 | 0.0683 | 0.5312 | 2.2 | 5jdo:B |
5 | 3hko:A | 319 | 24 | 0.0882 | 0.0376 | 0.5000 | 4.1 | |
6 | 3kd3:A | 216 | 58 | 0.1176 | 0.0741 | 0.2759 | 4.5 | 3kd3:B |
7 | 8udk:B | 369 | 30 | 0.0809 | 0.0298 | 0.3667 | 5.6 | |
8 | 2v5e:A | 200 | 46 | 0.0956 | 0.0650 | 0.2826 | 6.7 | |
9 | 5mtw:C | 138 | 23 | 0.0809 | 0.0797 | 0.4783 | 8.9 | 5mtw:A, 5mtw:D, 5mtw:B |
10 | 3c7t:A | 259 | 42 | 0.1103 | 0.0579 | 0.3571 | 9.6 | 3c7t:B, 3c7t:C, 3c7t:D |