PVAVQCGRLFDARSGQLKGPHTLLVADGRIRQVLPGARVVDLGDKVCLPGWTDLHVHLGSQSSPQSYSEDFRLDPVDHAF
RAVGYAEKTLMAGFTSVRDLGGEVSPHLRDAINQGLVRGPRIFAAGKSIATTGGHADPTNGWNERLAHLVGAPGPAEGVV
NSVDEARQAVRQRYKEGSDLIKITATGGVLSYARSGDAPQFTVDEIKAVVDTARDYGFRVAAHAHGTEGMKRAVQAGVTS
IEHGTYMDDEVMRLMKQHGTWYVPTFYAGRFVTEKAAIDGYFPEVVRPKAARIGALISQTAAKAYRNGVRIAFGTDQGVG
PHGDNAREFVYMVEAGIPAAYALQAATVHAAQVLGVDDQGVLEPGKRADVIALAGNPLEDINAVLDVRFVMKDGVIYKQ
The query sequence (length=399) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ihq:A | 399 | 399 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8ihq:B, 8ihq:C, 8ihq:D, 8ihq:E, 8ihq:F, 8ihq:G, 8ihq:H, 8ihr:A, 8ihr:B, 8ihr:C, 8ihr:D, 8ihr:E, 8ihr:F, 8ihr:G, 8ihr:H, 8ihs:A, 8ihs:B, 8ihs:C, 8ihs:D, 8ihs:E, 8ihs:F, 8ihs:G, 8ihs:H, 8j85:A, 8j85:B, 8j85:C, 8j85:D, 8j85:E, 8j85:F, 8j85:G, 8j85:H |
2 | 2qs8:A | 406 | 405 | 0.5188 | 0.5099 | 0.5111 | 8.02e-134 | 2qs8:B |
3 | 3be7:A | 398 | 403 | 0.3734 | 0.3744 | 0.3697 | 1.44e-78 | 3be7:E, 3be7:B, 3be7:D, 3be7:C, 3be7:F, 3be7:G, 3be7:H, 3dug:A, 3dug:B, 3dug:C, 3dug:D, 3dug:E, 3dug:F, 3dug:G, 3dug:H |
4 | 3mtw:A | 403 | 417 | 0.4085 | 0.4045 | 0.3909 | 3.24e-75 | |
5 | 3mkv:A | 414 | 413 | 0.3684 | 0.3551 | 0.3559 | 2.26e-57 | 3mkv:B, 3mkv:C, 3mkv:D, 3mkv:E, 3mkv:F, 3mkv:G, 3mkv:H |
6 | 3n2c:A | 408 | 412 | 0.3534 | 0.3456 | 0.3422 | 2.41e-54 | 3feq:A, 3feq:B, 3feq:C, 3feq:D, 3feq:E, 3feq:F, 3feq:G, 3feq:H, 3feq:I, 3feq:J, 3feq:K, 3feq:L, 3feq:M, 3feq:N, 3feq:O, 3feq:P, 3n2c:B, 3n2c:C, 3n2c:D, 3n2c:E, 3n2c:F, 3n2c:G, 3n2c:H, 3n2c:I, 3n2c:J, 3n2c:K, 3n2c:L, 3n2c:M, 3n2c:N, 3n2c:O, 3n2c:P |
7 | 4c5y:A | 436 | 376 | 0.3083 | 0.2821 | 0.3271 | 6.46e-44 | 4c5y:B |
8 | 4ub9:A | 467 | 458 | 0.2957 | 0.2527 | 0.2576 | 2.22e-14 | 4ub9:B, 4ub9:C, 4ub9:D, 4ub9:E, 4ub9:F, 4ub9:G, 4wgx:A |
9 | 4whb:A | 459 | 457 | 0.2657 | 0.2309 | 0.2319 | 2.25e-12 | |
10 | 4bjh:A | 422 | 76 | 0.0602 | 0.0569 | 0.3158 | 3.41e-04 | 3d6n:A |
11 | 6gdd:A | 375 | 76 | 0.0602 | 0.0640 | 0.3158 | 4.15e-04 | 6gde:A, 6gdf:A, 1xrf:A, 1xrt:A, 1xrt:B |
12 | 7cf6:A | 384 | 113 | 0.0777 | 0.0807 | 0.2743 | 0.001 | 7cdh:X, 7cf6:B, 7cf6:C, 7cf6:D |
13 | 3nqb:A | 587 | 63 | 0.0602 | 0.0409 | 0.3810 | 0.001 | 3nqb:B, 3t81:A, 3t81:B |
14 | 3icj:A | 468 | 187 | 0.1303 | 0.1111 | 0.2781 | 0.001 | |
15 | 6ohb:A | 435 | 422 | 0.2180 | 0.2000 | 0.2062 | 0.002 | 6ohb:B, 6ohb:C, 6ohb:D, 6ohc:A, 6ohc:B, 6ohc:C, 6ohc:D |
16 | 3lnp:A | 441 | 45 | 0.0551 | 0.0499 | 0.4889 | 0.011 | |
17 | 3lnp:A | 441 | 44 | 0.0401 | 0.0363 | 0.3636 | 0.024 | |
18 | 1onx:A | 389 | 73 | 0.0551 | 0.0566 | 0.3014 | 0.016 | 2aqo:A, 2aqo:B, 2aqv:A, 2aqv:B, 1onw:A, 1onw:B, 1onx:B, 1po9:A, 1po9:B, 1poj:A, 1poj:B, 1pok:B, 1pok:A, 1ybq:A, 1ybq:B |
19 | 3wic:A | 360 | 86 | 0.0627 | 0.0694 | 0.2907 | 0.070 | 3wic:B, 3wic:C, 3wic:D, 3wid:A, 3wid:B, 3wid:C, 3wid:D, 3wie:A, 3wie:B, 3wie:C, 3wie:D |
20 | 4f0r:A | 436 | 45 | 0.0501 | 0.0459 | 0.4444 | 0.072 | 4f0s:A |
21 | 1wa3:D | 203 | 108 | 0.0702 | 0.1379 | 0.2593 | 0.072 | 1wa3:A, 1wa3:B, 1wa3:C, 1wa3:E, 1wa3:F |
22 | 3mpg:A | 426 | 41 | 0.0451 | 0.0423 | 0.4390 | 0.14 | 3mpg:B, 4yiw:A, 4yiw:B |
23 | 4gz7:A | 492 | 27 | 0.0326 | 0.0264 | 0.4815 | 0.25 | 4h00:A, 4h01:A, 4lcq:A, 4lcr:A, 4lcs:A |
24 | 4v1x:E | 474 | 380 | 0.1980 | 0.1667 | 0.2079 | 0.28 | 4v1x:A, 4v1x:B, 4v1x:C, 4v1x:D, 4v1x:F, 4v1y:A, 4v1y:B, 4v1y:C, 4v1y:D, 4v1y:E, 4v1y:F, 4v1y:G, 4v1y:H, 4v1y:I, 4v1y:J, 4v1y:K, 4v1y:L |
25 | 2oof:A | 403 | 389 | 0.2256 | 0.2233 | 0.2314 | 0.28 | 2q09:A |
26 | 2i9u:A | 419 | 82 | 0.0576 | 0.0549 | 0.2805 | 0.42 | 2i9u:B |
27 | 2z00:A | 426 | 59 | 0.0551 | 0.0516 | 0.3729 | 0.48 | |
28 | 4cns:D | 479 | 135 | 0.0852 | 0.0710 | 0.2519 | 0.79 | 4cns:A, 4cns:B, 4cns:C |
29 | 1gkr:A | 451 | 58 | 0.0451 | 0.0399 | 0.3103 | 1.0 | 1gkr:B, 1gkr:C, 1gkr:D |
30 | 1o12:A | 363 | 64 | 0.0451 | 0.0496 | 0.2812 | 1.1 | 1o12:B |
31 | 7nut:A | 401 | 71 | 0.0576 | 0.0574 | 0.3239 | 1.4 | 7nut:B, 7nuu:A, 7nuu:B |
32 | 7bkb:G | 568 | 81 | 0.0576 | 0.0405 | 0.2840 | 1.4 | 7bkb:g, 7bkc:G, 7bkc:g |
33 | 4izt:A | 263 | 194 | 0.1153 | 0.1749 | 0.2371 | 2.0 | 4izs:A, 4izu:A, 4izv:A, 4izw:A, 5ny7:A, 5nyb:A, 5nyc:A, 5nye:A |
34 | 4tqt:D | 481 | 126 | 0.0877 | 0.0728 | 0.2778 | 2.7 | 4tqt:A, 4tqt:B, 4tqt:C, 4tqt:E, 4tqt:F |
35 | 2ftw:A | 484 | 42 | 0.0401 | 0.0331 | 0.3810 | 3.0 | |
36 | 2vun:A | 385 | 383 | 0.2281 | 0.2364 | 0.2376 | 3.3 | 2vun:B, 2vun:C, 2vun:D |
37 | 2g3f:A | 414 | 210 | 0.1303 | 0.1256 | 0.2476 | 4.2 | 2bb0:A, 2bb0:B, 2g3f:B |
38 | 2ood:A | 463 | 41 | 0.0301 | 0.0259 | 0.2927 | 4.6 | |
39 | 2ood:A | 463 | 35 | 0.0376 | 0.0324 | 0.4286 | 8.9 | |
40 | 1gkp:A | 458 | 33 | 0.0376 | 0.0328 | 0.4545 | 4.6 | 1gkp:B, 1gkp:C, 1gkp:D, 1gkp:E, 1gkp:F, 1gkq:A, 1gkq:B, 1gkq:C, 1gkq:D |
41 | 2vr2:A | 478 | 36 | 0.0401 | 0.0335 | 0.4444 | 5.1 | |
42 | 5t5i:A | 569 | 37 | 0.0351 | 0.0246 | 0.3784 | 5.1 | 5t5i:I, 5t5m:A, 5t61:A, 5t61:G, 5t61:M, 5t61:S, 5t61:Y, 5t61:e, 5t61:k, 5t61:q |
43 | 8sgr:A | 393 | 70 | 0.0526 | 0.0534 | 0.3000 | 5.6 | 1ivh:A, 1ivh:B, 1ivh:C, 1ivh:D, 8sgr:B, 8sgr:C, 8sgr:D |
44 | 2yll:A | 436 | 57 | 0.0326 | 0.0298 | 0.2281 | 6.1 | 4az5:A, 4az6:A, 4az7:A, 4azb:A, 2yl6:A, 2yl8:A |
45 | 6i5s:A | 445 | 54 | 0.0476 | 0.0427 | 0.3519 | 6.3 | |
46 | 4crm:P | 608 | 52 | 0.0326 | 0.0214 | 0.2500 | 6.9 | 7a1g:x, 8cah:x, 3j16:B |
47 | 3g77:A | 423 | 196 | 0.1228 | 0.1158 | 0.2500 | 7.1 | 1k6w:A, 1k70:A, 3o7u:A, 3r0d:A, 1r9x:A, 1r9y:A, 1r9z:A, 1ra0:A, 1ra5:A, 1rak:A, 3rn6:A |
48 | 7bi7:A | 279 | 63 | 0.0351 | 0.0502 | 0.2222 | 7.1 | 7bi7:B, 7jmb:A, 7jmb:B |
49 | 8us3:A | 552 | 134 | 0.0752 | 0.0543 | 0.2239 | 7.2 | 8us1:A |
50 | 5hmd:A | 456 | 37 | 0.0401 | 0.0351 | 0.4324 | 8.1 | 5hmd:B, 5hme:A, 5hme:B, 5hmf:A, 5hmf:B, 4lh8:A, 4lh8:B, 3ls9:A, 3ls9:B, 3lsb:A, 3lsb:B, 3lsc:A, 3lsc:B |
51 | 8b9d:3 | 569 | 125 | 0.0727 | 0.0510 | 0.2320 | 9.0 | |
52 | 6wvk:D | 1184 | 43 | 0.0401 | 0.0135 | 0.3721 | 9.0 | 6wvj:D |
53 | 6zca:Y | 1127 | 43 | 0.0401 | 0.0142 | 0.3721 | 9.1 | 6zfb:Y, 6zfb:y |
54 | 6eac:A | 476 | 130 | 0.0852 | 0.0714 | 0.2615 | 9.2 | 6eac:B, 6eac:C, 6eac:D |
55 | 2paj:A | 421 | 24 | 0.0276 | 0.0261 | 0.4583 | 9.3 |