BioLiP

>protein
PVALSFHDLHQLTRAAVERAQQLQVPVVVSIVDAHGTETVTWRMPDALLVSSELAPKKAWTAVAMKTATHELSDVVQPGA
ALYGLESHLQGKVVTFGGGYALWRDGILIGGLGISGGSVEQDMDIAQTAIAAINVGTHQ

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5cx7:E	139	139	1.0000	1.0000	1.0000	2.50e-98	5cx7:A, 5cx7:B, 5cx7:C, 5cx7:D, 5cx7:F, 5cx7:G, 5cx7:H, 5cx7:I, 5cx7:J, 5cx7:K, 5cx7:L, 5cx7:M, 5cx7:N, 5cx7:O, 5cx7:P
2	6c0z:A	137	121	0.3309	0.3358	0.3802	1.81e-15	6c0z:C, 6c0z:D
3	3fpv:A	141	98	0.2158	0.2128	0.3061	0.005	3fpv:B, 3fpv:C, 3fpv:D, 3fpv:E, 3fpv:G, 3fpv:F, 3fpv:H
4	3lpp:B	869	56	0.1079	0.0173	0.2679	0.51	3lpp:D
5	8gm4:A	462	43	0.1007	0.0303	0.3256	1.4
6	8fny:A	497	41	0.0935	0.0262	0.3171	4.6	8fny:C, 8fo6:A, 8gm5:A, 7shq:A
7	6w3o:B	252	72	0.1583	0.0873	0.3056	6.5	6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B
8	1lbg:A	357	36	0.1079	0.0420	0.4167	7.3	2bjc:A, 2bjc:B, 1cjg:A, 1cjg:B, 1efa:A, 1efa:B, 1efa:C, 1jwl:B, 1jwl:A, 1jwl:C, 2kei:A, 2kei:B, 2kej:A, 2kej:B, 2kek:A, 2kek:B, 1l1m:A, 1l1m:B, 1lbg:D, 1lbh:A, 1lbh:B, 1lbh:C, 1lbh:D, 1lcc:A, 1lcd:A, 1osl:A, 1osl:B, 2p9h:A, 2p9h:B, 2paf:A, 2paf:B, 2pe5:A, 2pe5:B, 2pe5:C, 4rzt:A, 4rzt:B, 4rzt:C, 4rzt:D, 1tlf:A, 1tlf:B, 1tlf:C, 1tlf:D
9	4pyt:A	302	42	0.1223	0.0563	0.4048	8.7
10	6z7p:A	1025	50	0.1223	0.0166	0.3400	8.9	8bqe:B, 8bqe:C, 8bqe:E, 8bqe:D, 8bqe:F, 8bqe:A, 5n8p:A, 5n8p:B, 5n8p:C, 5n8p:D, 5n8p:E, 5n8p:F, 5n97:A, 5n97:B, 5n97:C, 5n97:D, 5n97:E, 5n97:F, 7peo:A, 6t72:A

[Back]