PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEE
LLLRLTQEIALILGIPNEEVWVFITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGS
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ms8:A | 146 | 146 | 1.0000 | 1.0000 | 1.0000 | 6.16e-106 | 7ms1:A, 7ms3:A, 7ms9:A, 7ms9:B, 7ms9:H, 7ms9:I, 7ms9:K |
2 | 3ej3:C | 64 | 56 | 0.1301 | 0.2969 | 0.3393 | 0.002 | 3ej3:A, 3ej3:E, 3ej3:G, 3ej3:I, 3ej3:K |
3 | 1mww:C | 120 | 92 | 0.1575 | 0.1917 | 0.2500 | 0.008 | |
4 | 2opa:A | 61 | 56 | 0.1096 | 0.2623 | 0.2857 | 0.031 | |
5 | 2opa:A | 61 | 46 | 0.0890 | 0.2131 | 0.2826 | 6.5 | |
6 | 1bjp:A | 62 | 53 | 0.1233 | 0.2903 | 0.3396 | 0.39 | 6bgn:A, 6bgn:B, 6bgn:C, 6bgn:D, 6bgn:E, 6bgn:F, 6bgn:I, 6bgn:G, 6bgn:H, 6bgn:J, 6bgn:K, 6bgn:L, 6bgn:O, 6bgn:M, 6bgn:N, 1bjp:B, 1bjp:C, 1bjp:D, 1bjp:E, 5clo:M, 5clo:N, 5clo:O, 6ghw:C, 5tig:A, 5tig:B, 5tig:C, 5tig:F, 5tig:O, 5tig:P, 5tig:Q |
7 | 3kve:A | 484 | 23 | 0.0685 | 0.0207 | 0.4348 | 4.4 | 3kve:B, 3kve:C, 3kve:D |
8 | 3tiq:B | 214 | 52 | 0.1164 | 0.0794 | 0.3269 | 5.0 | 3tiq:A |
9 | 4krc:A | 297 | 20 | 0.0616 | 0.0303 | 0.4500 | 6.2 | 2pmi:A |
10 | 1reo:A | 484 | 24 | 0.0616 | 0.0186 | 0.3750 | 7.4 | 1tdk:A, 1tdn:A, 1tdo:A |
11 | 2q1w:A | 300 | 41 | 0.0959 | 0.0467 | 0.3415 | 7.5 | 2q1w:B, 2q1w:C |
12 | 5ezs:A | 320 | 46 | 0.0890 | 0.0406 | 0.2826 | 8.2 | 8t8n:A |
13 | 8smr:M | 204 | 53 | 0.1027 | 0.0735 | 0.2830 | 9.3 | 8snh:M |