BioLiP

>protein
PTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKN
QGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEEEQKELDEIT

The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8c6j:o	513	138	1.0000	0.2534	0.9420	5.04e-89	7a5p:E, 6ff4:E, 9fmd:W, 6icz:W, 6id0:W, 6id1:W, 5mqf:E, 6qdv:o, 8ro2:W, 7w59:W, 7w5a:W, 7w5b:W, 5xjc:W, 6zym:E
2	8i0w:W	440	135	0.9769	0.2886	0.9407	5.71e-88	5yzg:W
3	8ro0:W	496	138	0.3923	0.1028	0.3696	2.10e-28	8ro1:W
4	3jb9:g	148	119	0.2615	0.2297	0.2857	8.43e-07
5	8ewy:A	1049	85	0.1615	0.0200	0.2471	0.15	6aah:A, 6aah:B, 6bbu:A, 6c7y:A, 6dbn:A, 5e1e:A, 5e1e:B, 4e4l:A, 4e4l:E, 4e4l:B, 4e4l:D, 4e4n:A, 4e4n:B, 4e5w:A, 4e5w:B, 4ehz:A, 4ehz:B, 4ehz:C, 4ehz:D, 4ei4:A, 4ei4:B, 6elr:A, 6elr:B, 8ewy:B, 3eyg:A, 3eyh:A, 4fk6:A, 4fk6:B, 6ggh:A, 6ggh:B, 5hx8:A, 5hx8:B, 6hzu:A, 6hzu:B, 4i5c:A, 4i5c:B, 4ivb:A, 4ivb:B, 4ivc:A, 4ivc:B, 4ivd:A, 4ivd:B, 4k6z:A, 4k77:A, 4k77:B, 5khw:A, 5khw:B, 5khx:A, 6n77:A, 6n77:B, 6n78:A, 6n79:A, 6n7a:A, 6n7a:B, 6n7b:A, 6n7c:A, 6n7c:B, 6n7d:A, 6rsb:A, 6rsb:B, 6rsc:A, 6rsc:B, 6rsd:A, 6rsd:B, 6rse:A, 6rse:B, 6rsh:A, 6rsh:B, 6sm8:A, 6sm8:B, 6smb:A, 6smb:B, 7t6f:A, 7t6f:B, 6tpe:A, 6tpe:B, 6tpf:A, 6tpf:B, 6w8l:A, 5wo4:A, 5wo4:B
6	5ixi:A	436	63	0.1385	0.0413	0.2857	0.18	5ixd:A
7	8k9y:A	322	62	0.1538	0.0621	0.3226	5.9	8k9y:B
8	5xf9:D	455	33	0.1000	0.0286	0.3939	9.5	5xf9:H, 5xfa:D, 5xfa:H

[Back]