PTVKEIKSLQNFNRIAGVFHLLQMLAVLALANDFALPMTGTYLNGPPGTTFSAPVVILETPVGLAVALFLGLSALFHFIV
SSGNFFKRYSASLMKNQNIFRWVEYSLSSSVMIVLIAQICGIADIVALLAIFGVNASMILFGWLQEKYTQPKDGDLLPFW
FGCIAGIVPWIGLLIYVIAPGSTSDVAVPGFVYGIIISLFLFFNSFALVQYLQYKGKGKWSNYLRGERAYIVLSLVAKSA
LAWQIFSGTLIPAL
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6su3:X | 256 | 254 | 1.0000 | 0.9922 | 1.0000 | 0.0 | 6su3:A, 6su4:X, 6su4:A, 6uh3:A, 6uh3:B |
2 | 7clj:A | 250 | 252 | 0.4370 | 0.4440 | 0.4405 | 9.52e-60 | 6is6:A, 7u55:A |
3 | 7es1:A | 408 | 147 | 0.1496 | 0.0931 | 0.2585 | 6.5 | 7erx:A, 7es0:A, 7es2:A |