PTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPRHP
STLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTF
SRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
The query sequence (length=192) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4x2h:A | 192 | 192 | 1.0000 | 1.0000 | 1.0000 | 9.53e-144 | 4x2o:A |
2 | 8hfr:CW | 427 | 182 | 0.2448 | 0.1101 | 0.2582 | 2.57e-10 | 8hfr:EX, 4wwu:B, 4wwu:E, 4wwu:G |
3 | 1ez4:B | 318 | 134 | 0.1979 | 0.1195 | 0.2836 | 1.7 | 1ez4:A, 1ez4:C, 1ez4:D |
4 | 6tix:BBB | 533 | 64 | 0.1042 | 0.0375 | 0.3125 | 3.0 | 6tix:AAA |
5 | 7e7o:A | 2003 | 30 | 0.0729 | 0.0070 | 0.4667 | 3.6 | 7lkp:A |
6 | 7e7q:A | 1958 | 30 | 0.0729 | 0.0072 | 0.4667 | 3.7 | |
7 | 7m1q:A | 1911 | 30 | 0.0729 | 0.0073 | 0.4667 | 3.9 | |
8 | 8f5b:A | 1924 | 30 | 0.0729 | 0.0073 | 0.4667 | 3.9 | 7lkz:A |
9 | 6fec:u | 76 | 38 | 0.0781 | 0.1974 | 0.3947 | 4.6 | |
10 | 7o9q:B | 308 | 46 | 0.0729 | 0.0455 | 0.3043 | 6.9 | 7o9q:A |
11 | 6mfi:A | 264 | 59 | 0.1146 | 0.0833 | 0.3729 | 7.2 | |
12 | 6qxz:A | 79 | 32 | 0.0469 | 0.1139 | 0.2812 | 7.5 | |
13 | 7wbt:A | 899 | 61 | 0.0833 | 0.0178 | 0.2623 | 7.8 | 7wbt:B, 7wbu:A |
14 | 5fq6:C | 480 | 57 | 0.0885 | 0.0354 | 0.2982 | 8.2 | 5fq4:A, 5fq4:B, 5fq6:H, 5fq6:L, 5fq6:A, 5fq7:C, 5fq8:A, 5fq8:C |
15 | 2l7p:A | 100 | 32 | 0.0469 | 0.0900 | 0.2812 | 9.6 | 5yvx:A |