PTLTHLEDSLRHDPRGHQRQRLIDCLNEAARRLALELRQPHSADEYARLERQRQSCLAAVRVIDTLWTLHQ
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7y6c:D | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 1.61e-46 | 7y6c:A |
2 | 1s7n:B | 179 | 45 | 0.1831 | 0.0726 | 0.2889 | 1.6 | 1s7l:A, 1s7n:A, 1s7n:C, 1s7n:D |
3 | 8wrx:A | 86 | 61 | 0.2394 | 0.1977 | 0.2787 | 2.2 | |
4 | 8b9d:L | 87 | 67 | 0.2676 | 0.2184 | 0.2836 | 2.3 | 7plo:L |
5 | 7lv6:B | 559 | 35 | 0.1408 | 0.0179 | 0.2857 | 7.6 | 4m56:A, 4m56:B, 4m8u:A, 4maz:A, 4mb1:A, 5wcz:A, 5wcz:B |
6 | 4dlq:A | 353 | 49 | 0.2254 | 0.0453 | 0.3265 | 9.6 | |
7 | 7cp7:A | 430 | 29 | 0.1549 | 0.0256 | 0.3793 | 9.8 | 7cp6:A, 7cp6:B |