BioLiP

>protein
PTKAVTFYEDINYGGASVSLQPGNYTLSQLNTAKIPNDWMSSLKVPSGWTVDVYENDNFTGTKWTYTSDTPWVGNDANDK
MSSVKIYST

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3so1:H	89	89	1.0000	1.0000	1.0000	5.56e-61	5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G
2	3hzb:D	90	85	0.3483	0.3444	0.3647	1.73e-15	3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H
3	1prr:A	173	85	0.3258	0.1676	0.3412	6.83e-12	1nps:A, 1prs:A
4	1prr:A	173	84	0.3596	0.1850	0.3810	6.45e-11	1nps:A, 1prs:A
5	2k1w:A	85	38	0.2135	0.2235	0.5000	2.40e-05	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
6	2k1w:A	85	38	0.2022	0.2118	0.4737	0.004	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
7	6sli:A	482	53	0.2247	0.0415	0.3774	1.3	5cx8:A, 5cx8:B, 6sli:C, 6sli:F, 6sli:I, 6slj:D, 6slj:C, 6sln:C, 6sln:D, 6sm3:A, 6smq:A
8	4iok:A	557	53	0.1798	0.0287	0.3019	2.6	1fp7:A, 1fpm:A, 1fpm:B, 4iok:B, 4iol:A, 4iol:B, 4jjz:A, 4jjz:B, 4jki:A, 3qus:A, 3qus:B
9	5nmx:D	409	38	0.1461	0.0318	0.3421	2.8	5nmw:A, 5nmw:B, 5nmw:C, 5nmw:D, 5nmx:A, 5nmx:B, 5nmx:C
10	8g27:I	720	24	0.0899	0.0111	0.3333	3.0	8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B
11	5znh:A	314	33	0.1236	0.0350	0.3333	6.0	5zsx:A, 5zsz:A
12	6s6z:A	1083	57	0.1573	0.0129	0.2456	6.5	6s6z:D, 6s6z:B, 6s6z:H, 6s6z:F, 6s6z:G, 6s6z:E, 6s6z:C, 6sd0:A, 6sd0:B, 6sd0:C, 6sd0:D
13	1l9y:A	263	39	0.1124	0.0380	0.2564	6.6	1jt1:A, 1k07:A, 1k07:B, 1l9y:B, 5w90:A, 5wck:A, 5wck:B

[Back]