Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PTIAELRELSLRLLTKIPYLKMLVLFGSRATGNIDWDFAVLYDEEKYNLYIQNNPLAAFVIPGILGEIFKINSDKIDIVE
LNHCSKLIAHFVARDGKVLYEEDEFDKFQQRVLLSNTEIKKIEKTKLENIENFLQRWGV

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7ae9:G 147 145 1.0000 0.9456 0.9586 1.03e-95 7ae9:F, 7ae9:E
2 7bxo:E 125 96 0.2014 0.2240 0.2917 0.069 7aer:A, 7bxo:A, 6m6v:A
3 7t9g:A 445 28 0.0719 0.0225 0.3571 3.4 4f35:D, 4f35:A, 4f35:C, 6okz:C, 6okz:B, 7t9g:Y, 6wtx:C, 6wtx:D, 6wtx:A, 6wtx:B
4 8ip8:ta 77 36 0.0791 0.1429 0.3056 3.6 8ip9:ta, 8ipa:ta, 8ipb:ta, 8jiw:BZ, 8r57:Z
5 5xxu:Z 71 38 0.0719 0.1408 0.2632 3.7
6 3zd7:A 623 36 0.1007 0.0225 0.3889 4.5 8g7t:C
7 4m7e:C 175 58 0.1223 0.0971 0.2931 9.3 4m7e:D, 4mn8:B
8 6fqy:A 468 74 0.1295 0.0385 0.2432 9.4 6fqy:B, 6fqz:A, 6fqz:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218