PSSTILIPVVVHVVYNNSAQNISDAQIISQIQVLNEDFRRMNADQANTPSAFANLAGNANIEFKLARRDPNGNTTNGITR
TSTSTETFSMEMDNVKFSNLGGNNAWNTRRYLNIWVCNLGDDLLGYAQFPFEFQTKPNTDGVVIHYKHFGRDGSAESPYD
KGRTATHEVGHWLDLRHIWGDDGGSCSGTDNIADTPNQGGYNEGCPSFPKTDHCTNTSPGVMFMNYMDYTYDACMNLFTK
GQVERMRSLFDTQTGIRREMQIYANELTNP
The query sequence (length=270) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6r7u:B | 308 | 270 | 0.9963 | 0.8734 | 0.9963 | 0.0 | 7od0:AAA, 7od0:BBB, 7od0:CCC, 7od0:DDD, 7od0:EEE, 7od0:FFF, 6r7u:A, 6r7v:A, 6r7w:A |
2 | 8cdb:A | 306 | 255 | 0.5111 | 0.4510 | 0.5412 | 1.54e-84 | 8cd8:A, 8cd8:C, 8cdb:B, 8cdb:C, 8cdb:D, 8cdb:E, 8cdb:F, 8cdb:G, 8cdb:H, 8cdb:I, 8cdb:J, 8cdb:K, 8cdb:L, 8cdb:M, 8cdb:N, 2cki:A, 2cki:B, 2j83:A, 2j83:B, 3lum:A, 3lum:B, 3lum:C, 3lum:D, 3lun:A, 3lun:B |
3 | 8sl1:A | 843 | 154 | 0.1704 | 0.0546 | 0.2987 | 3.23e-11 | |
4 | 8hgg:C | 1484 | 146 | 0.1407 | 0.0256 | 0.2603 | 1.56e-05 | 8hgg:D, 8hgh:A, 8hgh:B |
5 | 8a7e:C | 1524 | 146 | 0.1370 | 0.0243 | 0.2534 | 4.48e-05 | 8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B |
6 | 7ufg:B | 1182 | 146 | 0.1370 | 0.0313 | 0.2534 | 6.81e-05 | 8d8o:B |
7 | 7ufg:A | 1151 | 146 | 0.1370 | 0.0321 | 0.2534 | 7.42e-05 | |
8 | 4b18:A | 427 | 57 | 0.0519 | 0.0328 | 0.2456 | 3.1 | 6wx9:A |
9 | 6skf:BE | 255 | 51 | 0.0519 | 0.0549 | 0.2745 | 3.6 | 6skg:BE, 6th6:BE |
10 | 7zkh:A | 266 | 88 | 0.0741 | 0.0752 | 0.2273 | 5.2 | 7zkg:A, 7zkg:B |
11 | 4j4m:B | 200 | 63 | 0.0704 | 0.0950 | 0.3016 | 8.5 | 4j4m:A |
12 | 2fmd:A | 232 | 47 | 0.0667 | 0.0776 | 0.3830 | 9.3 |