BioLiP

>protein
PSSTILIPVVVHVVYNNSAQNISDAQIISQIQVLNEDFRRMNADQANTPSAFANLAGNANIEFKLARRDPNGNTTNGITR
TSTSTETFSMEMDNVKFSNLGGNNAWNTRRYLNIWVCNLDLLGYAQFPFEFQTKPNTDGVVIHYKHFGRDGSAESPYDKG
RTATHEVGHWLDLRHIWGDDGGSCSGTDNIADTPNQGGYNEGCPSFPKTDHCTNTSPGVMFMNYMDYTYDACMNLFTKGQ
VERMRSLFDTQTGIRREMQIYANELTNP

The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6r7u:B	308	270	0.9963	0.8669	0.9889	0.0	7od0:AAA, 7od0:BBB, 7od0:CCC, 7od0:DDD, 7od0:EEE, 7od0:FFF, 6r7u:A, 6r7v:A, 6r7w:A
2	8cdb:A	306	255	0.5112	0.4477	0.5373	1.89e-83	8cd8:A, 8cd8:C, 8cdb:B, 8cdb:C, 8cdb:D, 8cdb:E, 8cdb:F, 8cdb:G, 8cdb:H, 8cdb:I, 8cdb:J, 8cdb:K, 8cdb:L, 8cdb:M, 8cdb:N, 2cki:A, 2cki:B, 2j83:A, 2j83:B, 3lum:A, 3lum:B, 3lum:C, 3lum:D, 3lun:A, 3lun:B
3	8sl1:A	843	154	0.1716	0.0546	0.2987	1.29e-10
4	8hgg:C	1484	145	0.1418	0.0256	0.2621	2.39e-05	8hgg:D, 8hgh:A, 8hgh:B
5	8a7e:C	1524	145	0.1381	0.0243	0.2552	6.69e-05	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
6	7ufg:B	1182	145	0.1381	0.0313	0.2552	1.06e-04	8d8o:B
7	7ufg:A	1151	145	0.1381	0.0321	0.2552	1.08e-04
8	4b18:A	427	57	0.0522	0.0328	0.2456	2.9	6wx9:A
9	6skf:BE	255	51	0.0522	0.0549	0.2745	3.2	6skg:BE, 6th6:BE
10	4j4m:B	200	63	0.0709	0.0950	0.3016	8.1	4j4m:A
11	2fmd:A	232	47	0.0672	0.0776	0.3830	9.0
12	1wni:A	198	37	0.0522	0.0707	0.3784	9.6

[Back]