PSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPT
EEYERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCRYVADVTMTAVEMMSH
The query sequence (length=153) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6m9a:C | 157 | 153 | 0.9739 | 0.9490 | 0.9739 | 4.49e-109 | 6i2z:A, 6i2z:B, 6m9a:A, 6m9a:B, 4uiq:A, 4uiq:B |
2 | 4uii:A | 132 | 151 | 0.2810 | 0.3258 | 0.2848 | 2.89e-14 | 4uii:B |
3 | 4zvb:A | 150 | 128 | 0.2614 | 0.2667 | 0.3125 | 2.89e-12 | 4zva:A, 4zva:B, 4zvb:B, 4zvb:C, 4zvb:D |
4 | 2w31:A | 152 | 77 | 0.1830 | 0.1842 | 0.3636 | 2.61e-10 | 2w31:B |
5 | 3obz:A | 290 | 25 | 0.0719 | 0.0379 | 0.4400 | 0.56 | |
6 | 5ohe:F | 155 | 72 | 0.1307 | 0.1290 | 0.2778 | 0.96 | 5ohe:A, 5ohe:B, 5ohe:C, 5ohe:D, 5ohe:E, 5ohe:G, 5ohe:H, 5ohf:A, 5ohf:B, 5ohf:C, 5ohf:D, 5ohf:E, 5ohf:F, 5ohf:G, 5ohf:H, 6otd:A |
7 | 3t0c:A | 737 | 107 | 0.1503 | 0.0312 | 0.2150 | 1.3 | |
8 | 6czy:A | 362 | 43 | 0.0915 | 0.0387 | 0.3256 | 5.1 | 6czy:B, 6czy:C, 6czy:D, 6czz:A, 6czz:B, 6czz:C, 6czz:D |
9 | 6fat:A | 508 | 47 | 0.0915 | 0.0276 | 0.2979 | 7.9 | 8bhh:B, 8bhh:A, 6fat:B |
10 | 4xb1:A | 319 | 47 | 0.1176 | 0.0564 | 0.3830 | 8.6 | 4xb1:B, 4xb2:A, 4xb2:B |
11 | 3b8a:X | 470 | 26 | 0.0850 | 0.0277 | 0.5000 | 9.1 |