BioLiP

>protein
PSAPSREVVKKNTSSKKSDAAPASADPAKAKKKKSPTGNEAALKNKNFNKDVAPPQSTATPFDRHSRTGKTDSKKKLQQG
WGQSDKRELEGEVEGTEDAEAELEAEAEENDES

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8c3a:i	121	108	0.9115	0.8512	0.9537	1.23e-66	8c3a:CL, 8cq7:i, 8cq7:CL, 8cqw:i, 8cqw:CL, 8cre:i, 8cre:CL, 8oeq:i, 8oeq:CL, 7pzy:i, 7q08:i, 7q0f:i, 7q0p:i, 7q0r:i
2	5dgv:SM	159	98	0.4602	0.3270	0.5306	8.19e-22	5fci:SM, 5fcj:SM, 5i4l:SM, 5lyb:SM, 5tga:SM, 5tgm:SM, 4v88:Ah, 4v8y:A7, 4v8z:A7
3	5dat:SM	159	98	0.4513	0.3208	0.5204	1.38e-21	8bn3:SM, 5dc3:SM, 6hhq:i, 6hhq:sM, 8k2d:CS, 7mpi:Bh, 7mpj:Bh, 7n8b:Bh, 5ndg:SM, 5ndg:sM, 5ndv:SM, 5ndw:SM, 5ndw:sM, 5on6:i
4	5dge:SM	159	100	0.4690	0.3333	0.5300	3.16e-21	5dgf:SM, 5mei:i, 5obm:SM, 5obm:sM, 5tbw:i, 4u3m:SM, 4u3n:SM, 4u3u:SM, 4u4n:SM, 4u4o:SM, 4u4q:SM, 4u4r:SM, 4u4u:SM, 4u4y:SM, 4u4z:SM, 4u50:SM, 4u51:SM, 4u52:SM, 4u53:SM, 4u55:SM, 4u56:SM, 4u6f:SM
5	5dgv:sM	104	54	0.2566	0.2788	0.5370	8.57e-09
6	5dat:sM	104	54	0.2478	0.2692	0.5185	2.80e-08	5dc3:sM
7	5fci:sM	104	54	0.2478	0.2692	0.5185	3.18e-08	5fcj:sM, 5i4l:sM, 5lyb:sM, 5mei:sM, 5on6:sM, 5tbw:sM, 5tga:sM, 4v88:Ch
8	5dge:sM	104	54	0.2478	0.2692	0.5185	4.47e-08	5dgf:sM, 5ndv:sM, 5tgm:sM, 4u3m:sM, 4u3n:sM, 4u3u:sM, 4u4n:sM, 4u4o:sM, 4u4q:sM, 4u4r:sM, 4u4u:sM, 4u4y:sM, 4u4z:sM, 4u50:sM, 4u51:sM, 4u52:sM, 4u53:sM, 4u55:sM, 4u56:sM, 4u6f:sM
9	5lsu:A	231	91	0.2124	0.1039	0.2637	0.73	7cro:I, 7e8d:K, 5lsu:B
10	7old:B	129	74	0.2035	0.1783	0.3108	1.7
11	6hac:A	342	32	0.1150	0.0380	0.4062	2.8	6hae:A, 6hae:K, 6hav:A
12	8u4z:A	313	29	0.1062	0.0383	0.4138	7.7

[Back]