BioLiP

>protein
PSAFFLFCSEYRPKIKGEHPGIGDVAKKLGEMWNNT

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6cik:N	90	38	1.0000	0.4000	0.9474	8.37e-21	6cg0:N, 6cim:N
2	6cij:N	133	38	1.0000	0.2707	0.9474	1.51e-20	5zdz:N, 5ze1:N, 5ze2:N
3	2gzk:A	159	38	1.0000	0.2264	0.9474	1.67e-20	9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H
4	5ze0:N	118	36	0.9167	0.2797	0.9167	2.23e-17	1ckt:A
5	1j5n:A	93	34	0.4444	0.1720	0.4706	3.61e-04
6	1e7j:A	74	34	0.4444	0.2162	0.4706	8.62e-04	3nm9:D, 3nm9:G, 3nm9:J, 3nm9:P, 3nm9:M, 3nm9:A, 1qrv:A, 1qrv:B, 8r1x:A
7	5jh0:D	157	36	0.3333	0.0764	0.3333	0.13	5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A
8	2q6v:A	370	37	0.3611	0.0351	0.3514	1.9	3cv3:A
9	6ohr:A	576	25	0.2500	0.0156	0.3600	3.4	6ohr:B, 6ohr:C, 6ohr:D, 6ohr:E, 6u8z:A
10	6wo1:A	551	28	0.3056	0.0200	0.3929	6.0
11	1pie:A	388	27	0.3056	0.0284	0.4074	6.1
12	7ajt:UR	482	27	0.2500	0.0187	0.3333	7.1	7aju:UR, 7d4i:B8, 7d5s:B8, 7d5t:B8, 7d63:B8, 6ke6:B8, 6lqp:B8, 6lqq:B8, 6lqr:B8, 6lqs:B8, 6lqt:B8, 6lqu:B8, 6lqv:B8, 6nd4:S, 7suk:LS, 5wlc:LS, 6zqa:UR, 6zqb:UR, 6zqc:UR, 6zqd:UR
13	5h59:A	311	37	0.3889	0.0450	0.3784	7.3	5h5j:A, 5h5j:C, 1jb9:A, 3lo8:A, 3lvb:A, 5vw2:A, 5vw3:A, 5vw4:A, 5vw5:A, 5vw6:A, 5vw7:A, 5vw8:A, 5vw9:A, 5vwa:A, 5vwb:A

[Back]