BioLiP

>protein
PRTVMVNLNIYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLE
KILVSVGCTCVTP

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5vb9:A	108	98	1.0000	0.8611	0.9490	6.87e-64	7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B
2	8uss:A	107	107	0.9140	0.7944	0.7944	1.87e-53
3	3jvf:B	104	90	0.5914	0.5288	0.6111	6.64e-34
4	8htu:H	95	28	0.1183	0.1158	0.3929	0.028	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
5	8opt:A	783	45	0.1398	0.0166	0.2889	0.61	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
6	8opp:A	670	45	0.1398	0.0194	0.2889	0.65
7	5by6:B	288	72	0.2043	0.0660	0.2639	1.1	5by6:A, 5by6:C, 5by6:D, 5m4z:A, 5m4z:B
8	2iag:A	471	51	0.1398	0.0276	0.2549	4.7	3b6h:A, 3b6h:B, 2iag:B
9	8jjm:A	484	43	0.1505	0.0289	0.3256	4.8	8jjm:B
10	6z1p:AR	274	58	0.2043	0.0693	0.3276	5.8
11	6igz:H	88	27	0.0753	0.0795	0.2593	7.5
12	4pu5:A	438	20	0.0968	0.0205	0.4500	7.9
13	4iru:C	296	37	0.1398	0.0439	0.3514	8.2
14	6wb7:A	296	52	0.1613	0.0507	0.2885	8.6	6wb7:B, 6wb7:C, 6wb7:D
15	8blw:B	626	34	0.0860	0.0128	0.2353	9.6	8ptd:A, 8ptf:A

[Back]