BioLiP

>protein
PRTVMVNLNIHNRPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREP
PHCPNSFRLEKILVSVGCTCVTPI

The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5vb9:A	108	104	0.9327	0.8981	0.9327	4.83e-67	7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B
2	8uss:A	107	108	0.9327	0.9065	0.8981	7.64e-64
3	3jvf:B	104	97	0.5385	0.5385	0.5773	1.86e-35
4	8jcu:3	765	28	0.1058	0.0144	0.3929	0.74	6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A
5	8tr2:A	745	28	0.1058	0.0148	0.3929	1.1	2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B
6	8opp:A	670	45	0.1250	0.0194	0.2889	2.5
7	8opt:A	783	45	0.1250	0.0166	0.2889	2.5	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
8	8htu:H	95	18	0.0769	0.0842	0.4444	3.0	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
9	7pog:A	2382	74	0.1923	0.0084	0.2703	3.1	4dmw:A, 3ho6:A, 3ho6:B, 4r04:A, 3srz:A, 3ss1:A, 7u2p:A, 7uby:B, 7uby:A, 5uqk:A, 5uql:A
10	6z1p:AR	274	55	0.1635	0.0620	0.3091	4.8
11	8jjm:A	484	43	0.1346	0.0289	0.3256	6.3	8jjm:B

[Back]