PRTVMVNLNIHNRNSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPH
CPNSFRLEKILVSVGCTCVTPI
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vb9:A | 108 | 102 | 0.9510 | 0.8981 | 0.9510 | 2.35e-67 | 7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B |
2 | 8uss:A | 107 | 108 | 0.9314 | 0.8879 | 0.8796 | 7.39e-62 | |
3 | 3jvf:B | 104 | 98 | 0.5490 | 0.5385 | 0.5714 | 7.30e-35 | |
4 | 5by6:B | 288 | 73 | 0.2157 | 0.0764 | 0.3014 | 1.3 | 5by6:A, 5by6:C, 5by6:D, 5m4z:A, 5m4z:B |
5 | 8opp:A | 670 | 45 | 0.1275 | 0.0194 | 0.2889 | 2.2 | |
6 | 8opt:A | 783 | 45 | 0.1275 | 0.0166 | 0.2889 | 2.2 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
7 | 8c8v:A | 1032 | 29 | 0.0980 | 0.0097 | 0.3448 | 2.5 | 8c8u:A, 8c8w:A, 8c9d:A |
8 | 8htu:H | 95 | 16 | 0.0784 | 0.0842 | 0.5000 | 3.6 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
9 | 6z1p:AR | 274 | 55 | 0.1667 | 0.0620 | 0.3091 | 3.9 | |
10 | 8jjm:A | 484 | 43 | 0.1373 | 0.0289 | 0.3256 | 6.0 | 8jjm:B |
11 | 4pu5:A | 438 | 20 | 0.0882 | 0.0205 | 0.4500 | 9.8 |