PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1u78:A | 103 | 51 | 1.0000 | 0.4951 | 1.0000 | 1.13e-32 | 1tc3:C |
2 | 7r04:A | 2326 | 21 | 0.2157 | 0.0047 | 0.5238 | 4.6 | |
3 | 4bed:B | 1734 | 27 | 0.1569 | 0.0046 | 0.2963 | 4.7 | 4bed:D, 3qjo:A, 3qjo:B |
4 | 7pgr:N | 2423 | 22 | 0.2353 | 0.0050 | 0.5455 | 5.8 | 2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N |
5 | 3npc:A | 357 | 41 | 0.2353 | 0.0336 | 0.2927 | 6.0 | 3e7o:A, 3e7o:B, 8elc:A, 7n8t:A, 3npc:B |
6 | 7ly7:B | 329 | 20 | 0.1765 | 0.0274 | 0.4500 | 7.3 | 7ly4:A, 7ly4:D, 7ly5:B, 7ly6:A |