PRGIPYFEKYAWLFMRFSGIALVFLALGHLFIMLMWQDGVYRIDFNYVAERWASPFWQIWDMALLWLAMIHGANGMRTII
GDYARKNVTKFWLNSLLLLATGFTLVLGSYVLVTFDANIS
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6lum:D | 146 | 120 | 1.0000 | 0.8219 | 1.0000 | 5.79e-85 | 6lum:H, 6lum:N |
2 | 2bs2:F | 254 | 116 | 0.2833 | 0.1339 | 0.2931 | 0.25 | 2bs2:C, 2bs3:F, 2bs3:C, 2bs4:F, 2bs4:C, 1e7p:C, 1e7p:F, 1e7p:I, 1e7p:L, 1qlb:C, 1qlb:F |
3 | 5hdt:A | 1085 | 54 | 0.1250 | 0.0138 | 0.2778 | 2.4 | 5hdt:B |
4 | 4kir:A | 460 | 44 | 0.1000 | 0.0261 | 0.2727 | 7.1 | 4kir:B, 4kqn:A, 4kqn:B, 1yny:A, 1yny:B |
5 | 3sfw:A | 461 | 46 | 0.1000 | 0.0260 | 0.2609 | 8.1 | 3sfw:B |
6 | 6fti:3 | 120 | 70 | 0.1833 | 0.1833 | 0.3143 | 9.2 | 8pn9:H |