PRCGGWVKLNTAPVCFSAKGNRPGSFTPSHHGFLKSVKLRHLRGLVTCQSSTDAHDSYWGCKNRCGFHNYPLNVFVTDKH
NKVMFPKTGATYYLDPYVIKNRFYGVQGYNAMSPELVLQHGCNSPSDYIGPDSQLRVWYGEDLYNTMESDNSGKVCADVF
GYFV
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6a56:A | 164 | 164 | 1.0000 | 1.0000 | 1.0000 | 4.76e-124 | 6a56:B |
2 | 7zgh:A | 413 | 53 | 0.1098 | 0.0436 | 0.3396 | 0.24 | 7zgh:B |
3 | 4f0p:B | 452 | 23 | 0.0549 | 0.0199 | 0.3913 | 1.3 | 4f0p:A, 4f0q:A, 4f0q:B, 4f0q:C, 4r28:C |
4 | 7pkt:m | 177 | 32 | 0.0610 | 0.0565 | 0.3125 | 1.3 | |
5 | 8rry:A | 170 | 73 | 0.1220 | 0.1176 | 0.2740 | 3.3 | 8rry:B |
6 | 7odf:A | 703 | 98 | 0.1585 | 0.0370 | 0.2653 | 4.4 | |
7 | 3wl7:A | 336 | 31 | 0.0854 | 0.0417 | 0.4516 | 5.7 | 3wl8:A, 3wwc:A |
8 | 3vsl:A | 631 | 45 | 0.0915 | 0.0238 | 0.3333 | 7.0 | 3vsl:B |
9 | 9c4g:r | 132 | 35 | 0.0732 | 0.0909 | 0.3429 | 8.4 | 8crx:r, 8cvm:r |