BioLiP

>protein
PQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQE

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ymb:D	231	73	1.0000	0.3160	1.0000	7.96e-48	4a5x:A, 4a5x:B, 2ymb:C
2	5fvl:A	83	70	0.3151	0.2771	0.3286	2.91e-10	5fvk:A, 5fvk:B, 5fvl:B, 4niq:A, 4niq:B
3	4u7y:A	83	71	0.3151	0.2771	0.3239	2.40e-06	2jqk:A
4	2k3w:A	73	66	0.3014	0.3014	0.3333	8.37e-06	2jq9:A
5	8uc6:B	148	69	0.2877	0.1419	0.3043	0.034	8uc6:C
6	8uc6:B	148	65	0.2329	0.1149	0.2615	2.2	8uc6:C
7	8d0k:D	419	44	0.2192	0.0382	0.3636	0.23	4bpu:A, 4bpu:C, 4bpw:A, 4bpw:C, 4bpx:A, 4bpx:C, 9c8v:A, 8d9d:A, 5exr:A, 5exr:E, 4lik:A, 4lil:A, 4mhq:A, 7opl:C, 8qj7:C, 6r4s:A, 6r4s:E, 6r4t:A, 6r4t:D, 6r4u:A, 6r4u:E, 6r5d:A, 6r5d:E, 6r5e:A, 6r5e:E, 6rb4:A, 4rr2:A, 4rr2:C, 7u5c:A
8	6c5c:A	385	37	0.2192	0.0416	0.4324	1.0	6c5c:B
9	5w8q:A	379	37	0.1781	0.0343	0.3514	2.1	5w8q:B, 5wc4:A, 5wc4:B
10	7cs6:F	300	50	0.1644	0.0400	0.2400	5.1	7cs3:A, 7cs3:B, 7cs3:C, 7cs3:D, 7cs3:E, 7cs3:F, 7cs4:E, 7cs4:A, 7cs4:F, 7cs4:D, 7cs4:C, 7cs4:B, 7cs5:E, 7cs5:A, 7cs5:F, 7cs5:D, 7cs5:C, 7cs5:B, 7cs6:A, 7cs6:B, 7cs6:C, 7cs6:D, 7cs6:E, 7cs7:A, 7cs7:B, 7cs7:C, 7cs7:D, 7cs7:E, 7cs7:F, 7cs8:A, 7cs8:B, 7cs8:C, 7cs8:D, 7cs8:E, 7cs8:F
11	7d58:A	1387	40	0.1644	0.0087	0.3000	5.7	7a6h:A, 7ae1:A, 7ae3:A, 7aea:A, 7fji:A, 7fjj:A, 8ity:A, 8iue:A, 8iuh:A
12	7dn3:A	1293	40	0.1644	0.0093	0.3000	5.9	7du2:A

[Back]