BioLiP

>protein
PQRLLIPTVDDPGIWGVKVRLGKEKDVVRQILKKKLAREGTKNPLEIYSAFQRDSFKGHVYIEARKAEAINDALKGNVNV
FSNNSKFLVGIVEYKDLLRPVSDVKLTRGSYVRVKNGKFKGDLAQVDEVLENGLEARLKLVPRLDYGKDLSYTSKFRPAQ
RLFSEAEARVHEIRRDRDGFVTYGGEEYYEGFLYKTFRLQNLIVNSINPTLNELSLFEVKVGDTVREFTGERRQGTILHV
YRNFLFLRSREIVENQGVFVTSSNRVGRDPTLNKTVKIRQGGYKGKIGIVKEANGDRFRVELHNPNKTIPIPCSFLLIES
THGWVPYED

The query sequence (length=329) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xon:W	329	329	1.0000	1.0000	1.0000	0.0
2	6ir9:W	275	329	0.8176	0.9782	0.8176	0.0	6j4w:W, 6j4x:W, 6j4y:W, 6j4z:W, 6j50:W, 6j51:W, 8jh2:W, 7wbv:W, 7wbw:W, 7wbx:W
3	7xn7:W	533	360	0.7173	0.4428	0.6556	3.21e-142	7xse:W, 7xsx:W, 7xt7:W, 7xtd:W, 7xti:W
4	7xn7:W	533	114	0.3374	0.2083	0.9737	8.24e-71	7xse:W, 7xsx:W, 7xt7:W, 7xtd:W, 7xti:W
5	8w8e:Z	360	365	0.3161	0.2889	0.2849	5.01e-30	8w8f:Z
6	5oik:Z	488	242	0.2462	0.1660	0.3347	2.88e-29	6gml:Z, 8p4f:Z, 8rbx:Z, 7ycx:j
7	5oik:Z	488	294	0.2401	0.1619	0.2687	4.26e-16	6gml:Z, 8p4f:Z, 8rbx:Z, 7ycx:j
8	7nkx:Z	156	130	0.1581	0.3333	0.4000	2.75e-17
9	7nkx:Z	156	41	0.0760	0.1603	0.6098	1.16e-08
10	2exu:A	192	89	0.1155	0.1979	0.4270	1.39e-13
11	4zn3:A	147	128	0.1094	0.2449	0.2812	7.68e-06
12	4zxh:A	1314	101	0.0881	0.0221	0.2871	0.032	4zxi:A
13	8oki:G	81	63	0.0547	0.2222	0.2857	1.2
14	5mrc:Q	284	44	0.0426	0.0493	0.3182	1.8	3j6b:Q, 5mre:Q, 5mrf:Q
15	3cxm:A	242	36	0.0274	0.0372	0.2500	5.1
16	3t7v:A	337	43	0.0456	0.0445	0.3488	5.7
17	6rm3:LT0	159	45	0.0456	0.0943	0.3333	7.8
18	2pmy:A	73	39	0.0456	0.2055	0.3846	8.6	2pmy:B

[Back]