PQPHKRWVFTLNNPSEDERKKIRDLPISLFDYFIVGEEGNEEGRTPHLQGFANFVKKQTFNKVKWYLGARCHIEKAKGTD
QQNKEFCSKEGNLLMECGAPRS
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wdz:D | 102 | 102 | 1.0000 | 1.0000 | 1.0000 | 1.28e-74 | 6wdz:A, 6wdz:G |
2 | 7kii:A | 103 | 100 | 0.4020 | 0.3981 | 0.4100 | 2.98e-17 | 7kij:C, 7kij:A |
3 | 4zda:A | 735 | 70 | 0.1863 | 0.0259 | 0.2714 | 0.032 | 4zda:B, 4zda:C, 4zda:D, 4zda:E, 4zda:F |
4 | 6g3u:A | 737 | 85 | 0.2157 | 0.0299 | 0.2588 | 0.033 | |
5 | 6u4b:A | 570 | 52 | 0.1471 | 0.0263 | 0.2885 | 2.3 |