PQFDILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKY
KTQKATILEASLKKLIPAWEFTIIPYYSDITDIVSSLQLQFESKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRF
TKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRN
SEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWS
DKTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSY
INRRI
The query sequence (length=405) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1p4e:B | 413 | 407 | 0.9827 | 0.9637 | 0.9779 | 0.0 | 1flo:A, 1flo:D, 1flo:B, 1flo:C, 1m6x:A, 1m6x:C, 1m6x:D, 1m6x:B, 1p4e:A, 1p4e:C, 1p4e:D |
2 | 8hw2:A | 1375 | 113 | 0.0667 | 0.0196 | 0.2389 | 1.5 | 8hw4:A |
3 | 8p0y:A | 66 | 35 | 0.0346 | 0.2121 | 0.4000 | 4.6 | 8p10:L |
4 | 7yfx:A | 746 | 90 | 0.0543 | 0.0295 | 0.2444 | 4.9 | 7yfy:A, 7ygn:A |
5 | 7qhv:AAA | 390 | 46 | 0.0346 | 0.0359 | 0.3043 | 7.1 | 7ofy:A, 7ofy:B, 7qhv:BBB, 8s5b:A, 7yzs:AAA, 7yzu:A |