PQFDILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKY
KTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIVSSLQLQFESKGNSHSKKMLKALLSEGESIWEITEKILNSFE
YTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDPLVYLD
EFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNV
VGNWSDKRTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYL
SSYINRRI
The query sequence (length=408) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1p4e:B | 413 | 408 | 0.9755 | 0.9637 | 0.9755 | 0.0 | 1flo:A, 1flo:D, 1flo:B, 1flo:C, 1m6x:A, 1m6x:C, 1m6x:D, 1m6x:B, 1p4e:A, 1p4e:C, 1p4e:D |
2 | 2zm5:A | 306 | 61 | 0.0441 | 0.0588 | 0.2951 | 3.1 | 3foz:A, 3foz:B, 2zm5:B, 2zxu:A, 2zxu:B |
3 | 6fb3:A | 1836 | 121 | 0.0760 | 0.0169 | 0.2562 | 4.4 | 6fb3:B, 6fb3:C, 6fb3:D, 6ska:A, 6ske:A, 6ske:C |
4 | 8p0y:A | 66 | 35 | 0.0343 | 0.2121 | 0.4000 | 4.5 | 8p10:L |
5 | 2nwb:A | 379 | 42 | 0.0319 | 0.0343 | 0.3095 | 8.0 |