PPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDAESAEVRAEIDHLLARQAAGEALSAGDLAPLAHELADLLYV
TYGALDQLGIDADAVFAEVHRANLSKASGPRRADGKQLKPEGWRPADVRGVIERLQHA
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yf3:C | 153 | 138 | 0.9928 | 0.8954 | 0.9928 | 2.40e-94 | 5hva:A, 5hva:B, 5hva:C, 5hva:D, 5hwu:A, 5hwu:B, 5hx1:A, 5hx1:C, 5hx1:B, 5hx1:D, 5hyl:A, 5hyl:C, 5hyl:B, 5hyl:D, 5hzz:A, 5hzz:B, 5hzz:C, 5hzz:D, 5i0j:A, 5i0j:D, 5i0j:B, 5i0j:C, 5i0m:A, 5i0m:D, 5i0m:B, 5i0m:C, 2yf3:A, 2yf3:B, 2yf3:D, 2yf3:E, 2yf3:F, 2yfc:A, 2yfc:B, 2yfc:C, 2yfc:D, 2yfd:A, 2yfd:B, 2yfd:C, 2yfd:D |
2 | 4rul:A | 823 | 91 | 0.1957 | 0.0328 | 0.2967 | 1.7 | 1cy1:A, 1cy2:A, 1cy4:A, 1cy6:A, 1cy7:A, 1cy8:A, 1mw8:X, 3px7:A |
3 | 2yxh:A | 114 | 69 | 0.1449 | 0.1754 | 0.2899 | 2.2 | 2yxh:B |
4 | 3tqo:A | 387 | 50 | 0.1377 | 0.0491 | 0.3800 | 3.8 |