PPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSIAIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGT
The query sequence (length=172) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2iph:A |
180 |
172 |
1.0000 |
0.9556 |
1.0000 |
1.97e-127 |
6bib:A, 6bib:B, 6bic:A, 6bic:B, 6bid:A, 5dg6:A, 5dgj:A, 5e0g:A, 5e0h:A, 5e0j:A, 4imq:A, 4imz:A, 4inh:B, 4inh:A, 4inh:C, 4inh:D, 4inh:E, 4inh:F, 4inh:G, 4inh:H, 2iph:B, 6t2i:A, 6t3g:A, 6t49:A, 6t4e:A, 6t4e:B, 6t5d:B, 6t5r:B, 5t6d:A, 5t6d:B, 5t6f:A, 5t6f:B, 5t6g:A, 5t6g:B, 6t6w:A, 6t71:B, 6t82:B, 6t8r:A, 6t8r:B, 6t8t:B, 6tal:B, 6taw:A, 6taw:B, 6tbo:A, 6tbo:B, 6tbp:A, 6tcf:B, 5tg1:A, 5tg2:A, 6tgl:B, 3ur9:A, 3ur9:B, 6w5h:A, 6w5h:B, 6w5h:C, 6w5h:D, 6w5j:A, 6w5j:B, 6w5k:A, 6w5k:B, 6w5k:C, 6w5k:D, 6w5l:A, 6w5l:B, 6w5l:C, 6w5l:D, 5wej:A, 5wej:B, 4xbb:A, 4xbc:A, 4xbd:A, 4xbd:B |
2 |
6nir:B |
170 |
170 |
0.6686 |
0.6765 |
0.6765 |
2.86e-87 |
8u1w:A |
3 |
4x2v:A |
174 |
171 |
0.5698 |
0.5632 |
0.5731 |
2.65e-71 |
4x2v:D |
4 |
3i0o:A |
329 |
49 |
0.1047 |
0.0547 |
0.3673 |
1.5 |
3i0q:A, 3q2m:A |
5 |
7bam:A |
1904 |
71 |
0.1337 |
0.0121 |
0.3239 |
2.4 |
7bam:B, 7ban:A, 7ban:B, 7bao:A, 7plp:A, 7plp:B |
6 |
4caz:A |
489 |
44 |
0.0930 |
0.0327 |
0.3636 |
3.8 |
4caz:B, 2wme:A, 2wme:B, 2wme:C, 2wme:D, 2wme:E, 2wme:F, 2wme:G, 2wme:H, 2wox:A, 2wox:B, 2wox:C, 2wox:D, 2xdr:A, 2xdr:B, 2xdr:C, 2xdr:D, 3zqa:A, 3zqa:B, 3zqa:C, 3zqa:D |
7 |
6vft:C |
420 |
76 |
0.1279 |
0.0524 |
0.2895 |
4.2 |
6vft:A, 6vft:B, 6vft:D |
8 |
1ekb:B |
235 |
86 |
0.1221 |
0.0894 |
0.2442 |
6.9 |
|
9 |
8skf:A |
497 |
31 |
0.0814 |
0.0282 |
0.4516 |
7.5 |
8skf:B, 8uzk:A, 8uzk:B, 8uzk:C, 8uzk:D, 8uzm:A, 8uzm:B, 8uzm:C, 8uzm:D, 8uzn:A, 8uzn:B, 8uzn:C, 8uzn:D, 8uzo:A, 8uzo:B, 8uzo:C, 8uzo:D, 8vj3:A, 8vj3:B, 8vj3:C, 8vj3:D, 8vqw:C, 8vqw:D, 8vqz:A, 8vqz:B, 8vqz:C, 8vqz:D, 8vr0:A, 8vr0:B, 8vr0:C, 8vr1:A, 8vr1:B, 8vr1:C, 8vr1:D |
10 |
3u4j:A |
505 |
44 |
0.0756 |
0.0257 |
0.2955 |
9.4 |
|