PPSIWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEF
NKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPAL
DLLDLSFLVVKNNMGEKHLFVDLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFS
DTLRILTCEP
The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5l2x:A | 271 | 251 | 1.0000 | 0.9225 | 0.9960 | 0.0 | 7jk1:A, 7jk1:B, 7jkl:A, 7jkl:B, 7jkp:A, 7jkp:B, 7jl8:A, 7jl8:B, 7jlg:A, 7jlg:B, 5l2x:B |
2 | 7s9v:A | 1296 | 77 | 0.1000 | 0.0193 | 0.3247 | 0.55 | |
3 | 6hzn:A | 743 | 45 | 0.0640 | 0.0215 | 0.3556 | 2.2 | |
4 | 6sjx:A | 182 | 78 | 0.0880 | 0.1209 | 0.2821 | 3.2 | 6sjw:A |
5 | 7w3u:A | 343 | 41 | 0.0560 | 0.0408 | 0.3415 | 3.5 | 7w3r:A, 7w3u:B, 7w3u:C |
6 | 8tj5:0 | 1246 | 22 | 0.0520 | 0.0104 | 0.5909 | 4.2 | 8tj5:Y |
7 | 6okp:K | 133 | 18 | 0.0400 | 0.0752 | 0.5556 | 6.0 | 7ugo:N, 7ugp:M, 7ugp:N |
8 | 6ieq:H | 231 | 17 | 0.0400 | 0.0433 | 0.5882 | 6.9 | 5cey:D, 8d50:H, 6mug:H, 6nnf:H, 5t3s:H, 5t3x:H, 8tgo:O, 8tgo:f, 7ucf:H |
9 | 6vly:A | 293 | 59 | 0.0720 | 0.0614 | 0.3051 | 7.5 | 6vly:B, 6vly:C, 6vly:D |