PPPGLPLWMGTFADLMSLLMCFFVLLLSFSEMDVLKFKQIAGSMKFAFGVQ
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8brd:G | 51 | 51 | 1.0000 | 1.0000 | 1.0000 | 4.88e-31 | |
2 | 2v45:A | 723 | 43 | 0.2941 | 0.0207 | 0.3488 | 0.44 | 2jim:A, 2jio:A, 2jip:A, 2jiq:A, 2jir:A, 2nap:A, 2v3v:A |
3 | 8dgf:A | 1541 | 19 | 0.1765 | 0.0058 | 0.4737 | 3.9 | 8dgf:B, 8dgf:C, 8dgf:D |
4 | 5eke:C | 307 | 51 | 0.2941 | 0.0489 | 0.2941 | 4.0 | 5eke:A, 5eke:B, 5eke:D, 5ekp:C, 5ekp:A, 5ekp:B, 5ekp:D |
5 | 5efq:C | 326 | 8 | 0.1373 | 0.0215 | 0.8750 | 6.5 | 5efq:A, 7nxj:A, 7nxj:C |