PPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALMAG
The query sequence (length=52) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ama:Y | 57 | 51 | 0.9423 | 0.8596 | 0.9608 | 7.75e-31 | 6ama:A, 6ama:B, 6ama:G, 6ama:H, 6ama:K, 6ama:L, 6ama:C, 6ama:D, 6ama:O, 6ama:P, 6amk:A, 6amk:B |
2 | 2zhg:A | 121 | 45 | 0.3462 | 0.1488 | 0.4000 | 0.003 | 2zhh:A |
3 | 5i44:B | 68 | 41 | 0.2885 | 0.2206 | 0.3659 | 0.055 | 5i44:A, 5i44:D, 5i44:E, 5i44:H, 5i44:J, 5i44:K, 5i44:G, 5i44:F, 5i44:I |
4 | 4ylr:A | 331 | 25 | 0.2500 | 0.0393 | 0.5200 | 0.41 | 4yls:A |
5 | 8btt:B | 484 | 39 | 0.2500 | 0.0269 | 0.3333 | 0.86 | |
6 | 8odp:A | 505 | 39 | 0.2500 | 0.0257 | 0.3333 | 1.0 | 8btt:A, 8odo:A, 8odo:C, 8odo:E, 8odo:G, 8odp:C, 8odp:E, 8odp:G, 7p3b:A, 7p3b:B |
7 | 2je2:A | 157 | 26 | 0.1923 | 0.0637 | 0.3846 | 1.1 | 8gar:A, 2je3:A |
8 | 2vz4:A | 100 | 46 | 0.2885 | 0.1500 | 0.3261 | 1.1 | |
9 | 3fkq:A | 354 | 20 | 0.1923 | 0.0282 | 0.5000 | 1.9 | |
10 | 7ohw:b | 259 | 37 | 0.2308 | 0.0463 | 0.3243 | 2.4 | |
11 | 8rry:A | 170 | 22 | 0.1731 | 0.0529 | 0.4091 | 4.9 | 8rry:B |
12 | 8thm:B | 462 | 36 | 0.2692 | 0.0303 | 0.3889 | 6.7 | 8thm:A, 8thm:C, 8thm:D, 8thm:F, 8thm:E |
13 | 5ncw:A | 334 | 43 | 0.2500 | 0.0389 | 0.3023 | 7.1 | 5nct:A |
14 | 8q9v:A | 543 | 18 | 0.1731 | 0.0166 | 0.5000 | 7.8 | 8q9u:A |
15 | 2r42:A | 383 | 58 | 0.2692 | 0.0366 | 0.2414 | 8.1 | 1kvk:A |
16 | 6n2m:A | 142 | 26 | 0.2115 | 0.0775 | 0.4231 | 8.3 | 6e25:A, 6n2m:B |