PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFL
PRNPSWKPLIH
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1xmt:A | 95 | 91 | 1.0000 | 0.9579 | 1.0000 | 9.61e-66 | 2il4:A, 2q4y:A |
2 | 2h5m:A | 102 | 86 | 0.2747 | 0.2451 | 0.2907 | 2.51e-05 | |
3 | 4hg6:A | 747 | 42 | 0.1538 | 0.0187 | 0.3333 | 0.13 | 5eiy:A, 5ej1:A, 5ejz:A, 4p00:A, 4p02:A |
4 | 6rtp:B | 484 | 84 | 0.2857 | 0.0537 | 0.3095 | 0.22 | 5jsh:B, 5jsk:B, 5jsu:B, 5jsy:B, 5jt1:B, 6ru9:B, 6ruc:B, 2wpn:B, 6z7r:B, 6z7r:D, 6z8j:B, 6z8j:D, 6z8m:B, 6z8o:B, 6z8o:D, 6z9g:B, 6z9g:D, 6z9g:F, 6z9g:H, 6z9o:B, 6za1:B, 3ze6:B, 3ze7:B, 3ze8:B, 3ze9:B, 3zea:B |
5 | 5xxm:A | 749 | 59 | 0.2198 | 0.0267 | 0.3390 | 0.69 | 5xxl:A, 5xxl:B, 5xxm:B, 5xxn:A, 5xxn:B, 5xxo:B, 5xxo:A |
6 | 6k80:A | 213 | 40 | 0.1319 | 0.0563 | 0.3000 | 3.6 | 5gi5:A, 5gi6:A, 5gi7:A, 5gi8:A, 5gi9:A, 5gif:A, 5gig:A, 5gih:A, 5gii:A, 3te4:A |
7 | 5w1h:A | 1301 | 33 | 0.1209 | 0.0085 | 0.3333 | 6.2 | 5w1i:A, 5w1i:C, 5wlh:A |
8 | 7exz:A | 324 | 31 | 0.1538 | 0.0432 | 0.4516 | 8.1 | 7bvr:A, 7bvr:C, 7bvr:E, 7bvr:G, 7exz:C, 7exz:E, 7exz:G, 7xrf:A, 7xrf:C, 7xrf:E, 7xrf:G |
9 | 1zbd:A | 177 | 39 | 0.1429 | 0.0734 | 0.3333 | 9.3 | 3rab:A |