PPHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDPERLRKSREHGMPPLAYDLLVREG
AWLPWLDALLAGYPAPANAAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPFLGAALQVAWSHWLLGLEGAVVE
TRTLCPACGSPPMAGMIRQTGLRYLSCSLCACEWHYVRIKCSHCEESKHLAYLSLGQPAEKAVLRAETCPSCQGYLKQFY
LEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAPGG
The query sequence (length=281) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2fiy:A | 285 | 285 | 0.9964 | 0.9825 | 0.9825 | 0.0 | 2fiy:B |
2 | 2d74:B | 137 | 54 | 0.0498 | 0.1022 | 0.2593 | 0.27 | 2dcu:B |
3 | 4r7e:A | 69 | 49 | 0.0569 | 0.2319 | 0.3265 | 5.8 | 8ieg:A, 8ieg:B, 8t3t:K, 8t3t:L, 8t3w:K, 8t3w:L, 8t3y:K, 8t3y:L |
4 | 8tfo:A | 390 | 37 | 0.0427 | 0.0308 | 0.3243 | 8.1 | 8tfo:B |
5 | 5wiv:A | 379 | 143 | 0.1388 | 0.1029 | 0.2727 | 9.0 | 5wiu:A |