BioLiP

>protein
PPEPTIRLQEDPDPEDENLYEKNPDSHGYDKDPIVDLWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVK
YREANGLPLMESNCFDPNKIQLPEDED

The query sequence (length=107) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7v2d:e	107	107	1.0000	1.0000	1.0000	1.92e-76	5lnk:w, 7v2c:e, 7v2e:e, 7v2f:e, 7v2h:e, 7v2k:e, 7v2r:e, 7v30:e, 7v31:e, 7v32:e, 7v33:e, 7v3m:e, 7vbl:e, 7vbp:e, 7vc0:e, 7vwl:e, 7vxs:e, 7vy1:e, 7vy9:e, 7vye:e, 7vyg:e, 7vyi:e, 7vys:e, 7vz8:e, 7vzv:e, 7vzw:e, 7w00:e, 7w0h:e, 7w0r:e, 7w0y:e, 7w1o:e, 7w1p:e, 7w1t:e, 7w1u:e, 7w1v:e, 7w1z:e, 7w20:e, 7w2k:e, 7w2l:e, 7w2r:e, 7w2u:e, 7w2y:e, 7w31:e, 7w32:e, 7w35:e, 7w4c:e, 7w4d:e, 7w4e:e, 7w4f:e, 7w4g:e, 7w4k:e, 7w4l:e, 7w4m:e, 7w4n:e, 7w4q:e
2	5xtc:e	97	95	0.7850	0.8660	0.8842	3.58e-62	5xtd:e, 5xth:e, 5xti:e, 5xti:Be
3	4wd6:A	219	57	0.1495	0.0731	0.2807	0.41	4wd6:B, 4zej:A, 4zej:B
4	2yck:X	272	22	0.1028	0.0404	0.5000	1.1	2yci:X, 2ycj:A
5	8bh6:s	84	46	0.1308	0.1667	0.3043	1.3	7aso:I, 7bge:s, 8bh7:s, 8byv:s, 6fxc:As, 6fxc:Bs, 7kwg:s, 5li0:s, 5nd8:s, 5nd9:s, 5ngm:As, 7nhl:t, 7nhm:t, 8p2f:t, 8p2g:t, 8p2h:t, 7p48:s, 6s0x:s, 6s13:s, 5tcu:SI, 8y38:s, 8y39:s, 6yef:s
6	7aor:w	175	23	0.1402	0.0857	0.6522	1.5
7	6p25:B	690	55	0.1215	0.0188	0.2364	3.2	6p2r:B
8	3o1a:A	383	35	0.1495	0.0418	0.4571	3.9	3oo3:A
9	6hiv:BM	245	94	0.2150	0.0939	0.2447	5.6	6hix:BM
10	8ity:4	365	24	0.1028	0.0301	0.4583	8.0	8iue:4, 8iuh:4

[Back]