PPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAHFVVTYHSFHWMKGTPFADDQGIYNGLTWWE
QMDNGQQLTRNRKFLTLVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yjk:D | 156 | 146 | 1.0000 | 0.9359 | 1.0000 | 6.80e-108 | 7yjk:H, 7yjm:D, 7yjn:D, 7yjo:D |
2 | 7yiu:D | 153 | 143 | 0.4247 | 0.4052 | 0.4336 | 6.38e-33 | 7cqi:A, 7cqk:A, 6m4o:A, 7yiy:D |
3 | 8iaj:D | 182 | 146 | 0.3904 | 0.3132 | 0.3904 | 1.72e-21 | 8iaj:H, 8iam:D, 8iam:H, 8qof:A, 8qof:E, 8qog:A |
4 | 8c80:A | 184 | 144 | 0.3425 | 0.2717 | 0.3472 | 1.18e-18 | 8c81:A, 8c82:A, 8c82:E |
5 | 7b9v:P | 74 | 32 | 0.0822 | 0.1622 | 0.3750 | 0.61 | 6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P |
6 | 4m0c:A | 212 | 21 | 0.0685 | 0.0472 | 0.4762 | 3.3 | 4m0c:B |
7 | 6lkc:B | 533 | 51 | 0.1233 | 0.0338 | 0.3529 | 6.2 | 6lkc:A |
8 | 7sze:B | 329 | 28 | 0.0890 | 0.0395 | 0.4643 | 6.9 | 7sze:A, 7sze:C, 7szf:A, 7szf:B, 7szf:C, 7szg:A, 7szg:B, 7szg:C, 6wnc:A, 6wnc:B, 6wnc:C, 6wnd:A, 6wnd:B, 6wnd:C |
9 | 6c01:A | 819 | 80 | 0.1575 | 0.0281 | 0.2875 | 7.4 | 6c01:B, 6c02:A, 6c02:B |
10 | 4gfr:A | 529 | 87 | 0.1712 | 0.0473 | 0.2874 | 7.7 | 8i5j:A, 8i5j:B, 8i5k:A, 1zu0:A |
11 | 6wn3:B | 328 | 23 | 0.0822 | 0.0366 | 0.5217 | 9.0 | 7szh:A, 7szh:B, 7szh:C, 6wn3:A, 6wn3:C, 6wnb:A, 6wnb:B, 6wnb:C |