BioLiP

>protein
PPAVDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSKPLSNCAGVGTCATCMVEIVNGKELLNPRTDI
EKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQLPEWKAHEWNIPKNI

The query sequence (length=128) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7wff:c	128	128	1.0000	1.0000	1.0000	3.91e-94	7wg5:c
2	7eu3:8	119	118	0.6562	0.7059	0.7119	9.19e-62	7f9o:8
3	3zyy:X	628	45	0.1172	0.0239	0.3333	4.80e-04	4c1n:J, 4c1n:I, 4c1n:K, 4c1n:X, 3zyy:Y
4	1l5p:A	93	44	0.1406	0.1935	0.4091	0.010	1l5p:B, 1l5p:C
5	5frt:E	105	52	0.1641	0.2000	0.4038	0.020	5ffi:E
6	1iue:A	98	73	0.1797	0.2347	0.3151	0.27	1iue:B
7	1b9r:A	105	70	0.1641	0.2000	0.3000	0.35
8	5frt:A	119	66	0.1406	0.1513	0.2727	0.40	5ffi:A, 5ffi:B, 5ffi:C, 5ffi:D, 5frt:B, 5frt:C, 5frt:D, 6yav:E, 6yav:A, 6yav:B, 6yav:C, 6yav:D
9	6ikg:A	644	48	0.1250	0.0248	0.3333	0.46	6ikg:B
10	4ltu:A	106	74	0.1797	0.2170	0.3108	1.1	4ltu:B
11	3dy5:A	1002	28	0.0781	0.0100	0.3571	2.6	3dy5:C, 1u5u:A, 1u5u:B
12	6kd7:A	327	42	0.1172	0.0459	0.3571	2.9
13	3hui:A	112	64	0.1641	0.1875	0.3281	3.4
14	2csv:A	72	49	0.1250	0.2222	0.3265	3.9
15	6nbl:D	107	66	0.1562	0.1869	0.3030	4.6	1gpx:A, 5gxg:B, 4jws:C, 4jws:D, 4jwu:C, 4jwu:D, 4jx1:C, 4jx1:D, 4jx1:G, 4jx1:H, 3lb8:C, 3lb8:D, 2m56:B, 6nbl:C, 1oqq:A, 1oqq:B, 1oqr:A, 1oqr:B, 1oqr:C, 1pdx:A, 1put:A, 1r7s:A, 1r7s:B, 1r7s:C, 3w9c:B, 1xln:A, 1xln:B, 1xlo:A, 1xlo:B, 1xlp:A, 1xlp:B, 1xlp:C, 1xlq:A, 1xlq:B, 1xlq:C, 1yji:A, 1yjj:A
16	3ah7:A	109	81	0.1719	0.2018	0.2716	4.9
17	1xxr:B	154	34	0.0938	0.0779	0.3529	7.2	1xxr:C, 1xxr:D
18	5oes:E	448	25	0.0703	0.0201	0.3600	10.0	5oes:A, 5oes:B, 5oes:C, 5oes:D, 5oes:F

[Back]