BioLiP

>protein
PNPSADTQPSDWAYIAEGGAHIVFSYQGQSKTYATRALRVRKPSNDVSGQWRRNILPKLVPRQLLTTSREVTLEEGWYKE
LLAMVDVVDRRGVLLEDLTSNVDDDGAITVAIEIKPKWGFLPCAGHLQPPESVSIKSHVSRFRLHQHFRGRADDPPYDPL
DLFSGDKMRMRTALDGLWTMWEISRGKSNNWKVFIGSKEISPDDLQRGLLPMGGDDLVTNITQLTLSALQTSSALPLLKN
LQQNLDPIDISSLAALFQAEHPNSPIFDPDLIAEVSAVELNSFVDIYISDPQAGQRMDSWSLRERIIAYALSAIFKDCSL
FVRGVLKHAEDGAWRLVSGGESVKVIDLDLKPVKNIQKWAETDEKVWKHWLKTKGTR

The query sequence (length=377) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xu6:C	379	379	1.0000	0.9947	0.9947	0.0	5xu6:A, 5xu6:B, 5xu6:D
2	6fl3:B	420	427	0.2785	0.2500	0.2459	2.07e-21	4axc:A, 4axf:A, 6fjk:B, 6fl8:B, 6gfg:B, 6gfg:A, 6gfh:A, 6gfh:B, 4lv7:B, 3udt:A, 3udt:B, 3udz:A, 3udz:B, 2xan:A, 2xao:A
3	4lv7:A	390	429	0.2944	0.2846	0.2587	1.97e-19	3uds:A, 3uds:B
4	4axd:A	433	447	0.2971	0.2587	0.2506	3.85e-19	4aqk:A, 4axe:A, 6fjk:A, 6fl3:A, 6fl8:A, 2xal:A, 2xal:B, 2xam:A, 2xam:B, 2xan:B, 2xao:B, 2xar:A, 2xar:B
5	5mwl:A	421	316	0.2095	0.1876	0.2500	2.86e-10	5mw8:A, 5mwl:B, 5mwm:A
6	4xz6:A	291	165	0.1061	0.1375	0.2424	1.0	4xz6:B
7	4b45:A	334	41	0.0371	0.0419	0.3415	3.4
8	1kkt:A	475	28	0.0265	0.0211	0.3571	7.1	1kre:B, 1kre:A, 1krf:A, 1krf:B, 2ri9:A, 2ri9:B
9	2glf:A	450	57	0.0504	0.0422	0.3333	9.3	2glf:B, 2glf:C, 2glf:D
10	6l8h:A	466	66	0.0557	0.0451	0.3182	9.9	6l8h:B, 6l8h:C, 6l8h:D

[Back]