PMVLLHKSTHIFPTDFASVSRAFFNRYPNPYSPHVLSIDTISRNVDQEGNLRTTRLLKKSGKLPTWITETWIIEVSVVNP
ANSTMKTYTRNLDHTGIMKVEEYTTYQFDSATSSTIADSRVKFSSGFNMGIKSKVEDWSRTKFDENVKKSRMGMAFVIQK
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6kyl:D | 160 | 160 | 1.0000 | 1.0000 | 1.0000 | 7.92e-119 | 6kyl:B |
2 | 6i3y:F | 182 | 168 | 0.3250 | 0.2857 | 0.3095 | 1.13e-24 | 6i3y:C |
3 | 6n7r:I | 147 | 90 | 0.1313 | 0.1429 | 0.2333 | 0.80 | |
4 | 7f8b:A | 245 | 62 | 0.1313 | 0.0857 | 0.3387 | 5.9 | 7f8c:A |
5 | 8r3q:D | 676 | 28 | 0.0625 | 0.0148 | 0.3571 | 7.3 | 8r3q:B, 8r3q:A, 8r3q:C |
6 | 3w81:A | 616 | 35 | 0.0688 | 0.0179 | 0.3143 | 8.2 | 6i6r:A, 6i6r:B, 6i6x:A, 6i6x:B, 4kgj:B, 4kgj:A, 4kgl:B, 4kgl:A, 4kh2:B, 4kh2:A, 4obr:B, 4obr:A, 3w81:B, 3w82:A, 3w82:B |
7 | 5tmb:A | 451 | 124 | 0.2250 | 0.0798 | 0.2903 | 9.9 | 6bk0:A, 6bk1:A, 6bk2:A, 6bk3:A, 5tmd:A, 5tme:A |